Property Summary

NCBI Gene PubMed Count 5
PubMed Score 58.52
PubTator Score 16.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.9e-03
invasive ductal carcinoma 1.200 5.7e-04
medulloblastoma, large-cell 1.200 7.5e-04
non primary Sjogren syndrome sicca 1.100 1.2e-02
ovarian cancer 1.100 8.4e-04

Synonym

Accession Q86U90 Q4W4X8 Q6NVW3 Q7L4E4 Q7Z2I4 Q9H5F8
Symbols IRIP
SUA5
DRIP3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MSPARRCRGMRAAVAASVGLSEGPAGSRSGRLFRPPSPAPAAPGARLLRLPGSGAVQAASPERAGWTEAL      1 - 70
RAAVAELRAGAVVAVPTDTLYGLACAASCSAALRAVYRLKGRSEAKPLAVCLGRVADVYRYCRVRVPEGL     71 - 140
LKDLLPGPVTLVMERSEELNKDLNPFTPLVGIRIPDHAFMQDLAQMFEGPLALTSANLSSQASSLNVEEF    141 - 210
QDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGLLPSHASYL     211 - 279
//

Text Mined References (20)

PMID Year Title