Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.59
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis -1.800 3.6e-03
glioblastoma 1.200 2.1e-07
medulloblastoma, large-cell 1.200 7.1e-06
pancreatic ductal adenocarcinoma liver m... -1.852 7.3e-03
tuberculosis 1.200 1.8e-06
psoriasis 1.400 5.9e-18
gastric carcinoma -3.000 2.3e-02
ovarian cancer 1.400 7.9e-05

AA Sequence

MHPAGLAAAAAGTPRLRKWPSKRRIPVSQPGMADPHQLFDDTSSAQSRGYGAQRAPGGLSYPAASPTPHA      1 - 70
AFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYVGRKLGLLFFPYLHQDWEVQY     71 - 140
QQDTPVAPRFDVNAPDLYIPAMAFITYVLVAGLALGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYL    141 - 210
VTVNTDLTTIDLVAFLGYKYVGMIGGVLMGLLFGKIGYYLVLGWCCVAIFVFMIRTLRLKILADAAAEGV    211 - 280
PVRGARNQLRMYLTMAVAAAQPMLMYWLTFHLVR                                        281 - 314
//

Text Mined References (14)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18685031 2008 Targeting of the 5-HT1A serotonin receptor to neuronal dendrites is mediated by Yif1B.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.