Property Summary

NCBI Gene PubMed Count 11
PubMed Score 89.00
PubTator Score 10.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.3e-06
lung cancer 4473 6.4e-06
psoriasis 6685 4.6e-04
intraductal papillary-mucinous adenoma (IPMA) 2956 6.6e-04
Disease Target Count Z-score Confidence
Heart conduction disease 65 0.0 1.0

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.200 4.6e-04
osteosarcoma -1.596 1.3e-06
intraductal papillary-mucinous adenoma (... 1.100 6.6e-04
lung cancer 2.300 6.4e-06

Gene RIF (4)

PMID Text
25855559 Single nucleotide polymorphisms in nNOS, renalase, MTHFR, CELSR1 and XYLB genes were found significantly associated with ischemic stroke in Chinese patients.
23179721 Xylulose binds to domain-I and ADP to domain-II, but in an open form of D-xylulokinase they are 10 A apart, implying that a large scale conformational change is required for catalysis.
23027762 crystals of D-xylulokinase proved to be trigonal, with point-group symmetry 3 and unit-cell parameters a = b = 101.87, c = 158.85 A degrees
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQ      1 - 70
ALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDS     71 - 140
STTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSP    141 - 210
IDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGD    211 - 280
NPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNES    281 - 350
VSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKR    351 - 420
IHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFS    421 - 490
EVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTRGPPE                            491 - 536
//

Text Mined References (15)

PMID Year Title
25855559 2015 Pooled genetic analysis reveals an association of SNPs of only a few genes with risk predisposition to ischemic stroke in a Chinese population.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23179721 2013 Structure and function of human xylulokinase, an enzyme with important roles in carbohydrate metabolism.
23027762 2012 Use of a repetitive seeding protocol to obtain diffraction-quality crystals of a putative human D-xylulokinase.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19389651 2009 Genome-wide association study of electrocardiographic conduction measures in an isolated founder population: Kosrae.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10231028 1999 Characterization of a 1200-kb genomic segment of chromosome 3p22-p21.3.
9763671 1998 Genomic structure of a novel human gene (XYLB) on chromosome 3p22-->p21.3 encoding a xylulokinase-like protein.