Property Summary

Ligand Count 66
NCBI Gene PubMed Count 118
PubMed Score 506.61
PubTator Score 823.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 0.6
Melanoma 711 0.0 0.9
Skin cancer 469 0.0 0.8
Disease Target Count
Deficiency of xanthine oxidase 1

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer -3.600 1.2e-16
cystic fibrosis 1.700 7.1e-05
intraductal papillary-mucinous neoplasm ... 4.600 2.0e-03
lung adenocarcinoma 1.700 5.6e-12
lung carcinoma 1.700 8.1e-27
medulloblastoma, large-cell 1.400 6.8e-05
non-small cell lung cancer 1.567 1.6e-10
osteosarcoma 1.562 5.6e-06
ovarian cancer 1.600 7.0e-13
pancreatic cancer 1.800 2.8e-04
pancreatic ductal adenocarcinoma liver m... -2.028 3.3e-04
periodontitis 1.100 7.8e-20
psoriasis 1.700 3.7e-04
ulcerative colitis 1.400 6.1e-04

 OMIM Phenotype (1)

Gene RIF (99)

AA Sequence

MTADKLVFFVNGRKVVEKNADPETTLLAYLRRKLGLSGTKLGCGEGGCGACTVMLSKYDRLQNKIVHFSA      1 - 70
NACLAPICSLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTMEEIE     71 - 140
NAFQGNLCRCTGYRPILQGFRTFARDGGCCGGDGNNPNCCMNQKKDHSVSLSPSLFKPEEFTPLDPTQEP    141 - 210
IFPPELLRLKDTPRKQLRFEGERVTWIQASTLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVC    211 - 280
PAWIPELNSVEHGPDGISFGAACPLSIVEKTLVDAVAKLPAQKTEVFRGVLEQLRWFAGKQVKSVASVGG    281 - 350
NIITASPISDLNPVFMASGAKLTLVSRGTRRTVQMDHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSA    351 - 420
FKQASRREDDIAKVTSGMRVLFKPGTTEVQELALCYGGMANRTISALKTTQRQLSKLWKEELLQDVCAGL    421 - 490
AEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVLQKLGQENLEDKCGKLDPTFASATLLFQKDPPADVQL    491 - 560
FQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCDDIPRYENELSLRLVTSTRAHAKIKSIDTSEAKKVP    561 - 630
GFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIE    631 - 700
DAIKNNSFYGPELKIEKGDLKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVPKGEAGEMELFVSTQNT    701 - 770
MKTQSFVAKMLGVPANRIVVRVKRMGGGFGGKETRSTVVSTAVALAAYKTGRPVRCMLDRDEDMLITGGR    771 - 840
HPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFHMDNCYKIPNIRGTGRLCKTNLPSNT    841 - 910
AFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEGDLTHFNQKLEGFTLPRCWEECLASSQYHA    911 - 980
RKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFLNQAGALLHVYTDGSVLLTHGGTEMGQGLHTKMVQV    981 - 1050
ASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILKRLEPYKKKNPSGSWEDWVTA   1051 - 1120
AYMDTVSLSATGFYRTPNLGYSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPA   1121 - 1190
IDIGQVEGAFVQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKKAIYASKAV   1191 - 1260
GEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVTGVPENCKPWS   1261 - 1330
VRV                                                                      1331 - 1333
//

Text Mined References (124)

PMID Year Title