Property Summary

NCBI Gene PubMed Count 107
PubMed Score 485.93
PubTator Score 823.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis 2.700 6.6e-120
osteosarcoma 1.562 5.6e-06
periodontitis 1.100 7.8e-20
medulloblastoma, large-cell 1.400 6.8e-05
pancreatic ductal adenocarcinoma liver m... -2.028 3.3e-04
non-small cell lung cancer 1.567 1.6e-10
intraductal papillary-mucinous neoplasm ... 4.600 2.0e-03
pancreatic cancer 1.800 2.8e-04
cystic fibrosis 1.700 7.1e-05
lung adenocarcinoma 1.700 5.6e-12
lung carcinoma 1.700 8.1e-27
Breast cancer -3.600 1.2e-16
ulcerative colitis 1.400 6.1e-04
ovarian cancer 2.000 2.8e-05

 OMIM Phenotype (1)

 GWAS Trait (1)

Gene RIF (88)

PMID Text
26863601 XDH and SUCLA2 genes associated with thiopurine-induced leukopenia can act in a complex interactive manner in patients with Crohn's disease.
26426087 beneficial effects observed with XO inhibitors on cardiovascular disease in chronic kidney disease may also be due to the reduction of oxidative stress
26353179 genetic association studies in population in Mexico: Data suggest that SNPs in XO (1936A>G, 2107A>G) are not associated with development of typical adverse reactions to methotrexate in pediatric patients with ALL (acute lymphoblastic leukemia).
26342297 Thyroid stimulating hormone levels are increase in gout patients treated with inhibitors of xanthine oxidoreductase.
26239312 The XDH gene polymorphisms rs1042039, rs1054889, and rs2073316 were shown to be associated with hypertension in a rural Chinese population.
26119820 Data suggest that, with aging, up-regulation of reactive oxygen species derived from XO down-regulates uric acid excretion via down-regulation of active homodimer breast cancer resistance protein (BCRP1, uric acid efflux transporter) in ileal mucosa.
26029922 the essential role of autophagy-regulated early ROS in triggering late apoptotic signaling
25800347 XOR regulated macrophage IL-1b secretion upon NLRP3 inflammasome activation via xanthine oxidase derived reactive oxygen species.
25582077 xanthine oxidase-mediated ROS production is required for PTN-induced cell migration through the cell membrane functional complex of alphanubeta3 and RPTPbeta/zeta and activation of c-src, PI3K and ERK1/2 kinases
25537183 These results supported the possibility that XO/XD and AO can contribute to nitric oxide generation.
25501928 In this review, we focus on studies of XOR inhibitors and their implications for understanding the chemical nature and reaction mechanism of the Moco active site of XOR
25463089 Xanthine oxidoreductase has roles in atherosclerosis pathogenesis [review]
25200751 Xanthine oxidase is activated in THP-1 human myeloid cells in response to pro-inflammatory and growth factor stimulation.
25185415 XOR activity is significantly associated with NAFLD
25044064 these data support a novel function of the XO-NFAT5 axis in macrophage activation and TLR-induced arthritis
24967004 XO is present in the pathogenesis of metabolic syndrome.
24591758 In infection with E. coli both XO and MPO urine levels were increased.
24506204 Xanthine dehydrogenase takes part in retinoic acid biosynthesis in the thyroid glandular epithelia.
24357442 xanthine oxidoreductase may have a function in the formation or persistence of chronic wounds
24092361 Results confirm the role of XO enzyme in ischemic heart disease.
23892358 This study reveals a noncanonical molecular pathway in which, after the inhibition of cathepsin S, autophagy induces early reactive oxygen species production for oxidative DNA damage and cell death through xanthine oxidase.
23819009 An upregulated XOD may be implicated in hrmodialysis-induced oxidative injury.
23597150 Inhibition of XO increased survival of human embryo brain-derived cells in culture. . There was a a reversed correlation between the activities of XO and DPD over 12 days under normal conditions as well as in the presence of XO and DPD inhibitors.
23443115 The polymorphisms rs1052133 on OGG1 and rs207454 on XDH show a trend of association with overall survival.
23340314 Xanthine oxidase released during enteropathogenic Escherichia coli and Shiga-toxigenic Escherichia coli infection may serve as a virulence-inducing signal to the pathogen and not solely as a protective host defense.
23315321 SNPs at the 5'-nucleotidase and xanthine oxidase genes influence the risk of noncirrhotic portal hypertension in HIV patients treated with didanosine.
23249873 Xanthinuria Type I is caused by mutations in the xanthine dehydrogenase gene (XDH). We report on a patient suffering from xanthinuria. Genomic DNA was screened for point mutations and imbalances in the XDH gene by sequencing and microarray typing.
23142692 Data suggest that XOD is up-regulated in lens of patients with (1) diabetes type 2 with cataracts and (2) senile cataracts; blood HbA1C levels (or poor glycemic control) are positively correlated with lens XOD activity as well as serum XOD activity.
22981351 Site-directed mutagenesis followed by expression analysis in Escherichia coli revealed that not only the frame shift mutation 141insG impairs XDH activity, but also the missense mutation C2729T.
22678977 high tumoral XDH expression is an independent predictor of a poor prognosis in patients with adenocarcinoma of the lung.
22495427 XDH genetic polymorphisms may influence azathioprine treatment outcome in patients with kidney transplants.
22266962 XO significantly decreases glucose transporter GLUT1 gene and protein expression and resultant glucose uptake in the placenta.
22168506 Serum XO activities were higher in women with polycystic ovary syndrome than in the control women (p<0.001).
22105431 There was no significant difference in XO activity between Swedes and Koreans
22044687 Decreased XOR is associated with poorer prognosis in patients with serous ovarian cancer.
22029190 Lower PON1 and high xanthine oxidase enzyme activities cause an imbalance of the free radical system.
21963464 xanthine oxidase activities in patients were 0 and 0.4 pmol/h/mL of plasma. We found three nonsense changes: p.P214QfsX4 and unpublished p.R825X and p.R881X
21826556 Xanthine oxidase plays an important role in the age-related oxidative stress in tissues and immune cells.
21775420 These results show that XOR is an important functional component of differentiation whose diminished expression contributes to breast cancer aggressiveness
21644044 The results indicated that anti-HXOR antibodies in synovial fluids have a protective role as high concentrations against XOR were detected in inflammatory arthritis.
21382276 the elevation of serum XOR during the three weeks following LT for the first time, as well as the influence of the graft reperfusion technique on XOR serum levels.
21059659 XOR promotes the inflammatory state of mononuclear phagocytes through effects on chemokine expression, PPARgamma SUMOylation, and HIF-1alpha
20930425 13 polymorphisms were identified in 196 unrelated Japanese. genetic variation in the promoter region of XO may determine interindividual differences in XO gene expression.
20570389 Low XOR expression was associated with shortened survival and also conferred a worse prognosis for patients with non-small cell lung cancer (NSCLC).
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20346360 Observational study of gene-disease association. (HuGE Navigator)
20077140 Case Report: hereditary xanthinuria with xanthine dehydrogenase deficiency due to novel sequence variations presenting as rheumatoid arthritis.
19898482 Observational study of gene-disease association. (HuGE Navigator)
19765958 Non-diabetic, non-smokers, non-hypertensive and untreated patients with familial combined hyperlipidemia present with increased levels of XO and NFKB activity.
19693777 The potential regulatory effect of oestrogen (17beta-estradiol) on one key player in retinoic acid biosynthesis, the xanthine dehydrogenase (XDH), was investigated.
19628957 Decreased paraoxonase activity as well as increased adenosine deaminase and xanthine oxidase activities and nitrite levels indicate that oxidative stress is increased and purine metabolism is altered in pseudoexfoliation syndrome.
19567609 xanthine oxidase may have a role in idiopathic pulmonary arterial hypertension
19539448 Exposure of human keratinocytes to ischemia, hyperglycemia and their combination induces oxidative stress via the enzymes inducible nitric oxide synthase and xanthine oxidase.
19531472 PRY/SPRY/B30.2 domain of butyrophilin 1A1 (BTN1A1) binds to xanthine oxidoreductase
19505917 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19500084 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19196876 As preeclampsia is characterized by heightened inflammation, oxidative stress, and hyperuricemia, xanthine oxidase may play a pivotal role in preeclampsia, the hypertensive disorder of pregnancy.
18840375 this study was to assess the activities of cytochrome P450 (CYP) 1A2, N-acetyltransferase 2, xanthine oxidase, and CYP2D6 in children with isolated idiopathic GH deficiency before and 3 and 6 months after initiation of r-hGH treatment.
18823306 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18821156 XO is implicated in the exercise-induced muscle oxidative stress of COPD patients
18818408 Mechanisms underlying erythrocyte and endothelial nitrite reduction to nitric oxide in hypoxia: role for xanthine oxidoreductase and endothelial nitric oxide synthase.
18775690 XO activity, but not oxidative damage parameters, at the time of sepsis diagnosis was significantly higher in non-survival septic patients.
18772145 hXOR is a tumor suppressor-targeted gene and the phosphorylation of SAFB1 is regulated by OSM, which provides a molecular basis for understanding the role of SAFB1-regulated hXOR transcription in cytokine stimulation and tumorigenesis
18767115 XOR derived ROS mediated the migratory effect and also modulated COX-2 and MMP levels and function.
18712049 Genetic variations in xanthine dehydrogenase contribute partly to hypertension and its complications, including atherosclerosis and chronic kidney disease.
18712049 Observational study of gene-disease association. (HuGE Navigator)
18678861 rhinovirus infection proteolytically activates XO initiating a pro-inflammatory vicious circle driven by virus-induced depletion of intracellular reducing power
18649358 Observational study of gene-disease association. (HuGE Navigator)
18635756 Report no effect of age and gender on pharmacokinetics, pharmacodynamics, and safety of febuxostat, a novel nonpurine selective inhibitor of xanthine oxidase.
18569334 The NAD+ dependent retinol oxidation catalyzed by xanthine dehydrogenase is strictly dependent on cellular retinol binding proteins and is inhibited by oxypurinol
18386220 Exogenous XO activity is an important contributor to endothelial mechanisms for microvascular rarefaction, by modulation of cell survival signaling pathways; however, endogenous XO is necessary for maintaining endothelial cell survival
18300946 several single nucleotide polymorphisms in the XO gene are involved in individual variations in XO activity. In addition, such findings will be useful to identify xanthinuria patients.
18300946 Observational study of gene-disease association. (HuGE Navigator)
17906999 A role for xanthine oxidase in ageing.
17622935 Observational study of gene-disease association. (HuGE Navigator)
17622935 These results suggest that polymorphisms -337GA and 565+64CT of XDH gene are related with blood pressure and oxidative stress in hypertension, adding evidence to the role of xanthine oxidoreductase and oxidative stress in blood pressure.
17523077 The role of conjunctival epithelial cell XO in oxidative reactions on the ocular surface of dry eye patients with Sjogren's syndrome was studied.
17301077 Xanthine dehydrogenase/oxidase is a moonlighting protein that has two distinct catalytic activities as a dehydrogenase and an oxidase.
17301077 findings show that mutation of two amino acid residues in the active site of XOR for purine substrates results in conversion of the substrate preference to aldehyde oxidase type
16935971 XOR expression in gastric cancer may be a new marker for a more aggressive gastric cancer biology, similar to that previously reported for breast cancer.
16758302 The results of this study revealed that, MPO, XO and SOD conditions in gastric mucosa alone were not affected from HP presence. That's why MPO, XO, and SOD may not have important roles in the pathogenesis of HP related gastric disease in children.
15451061 XOR is expressed primarily in hepatocytes, but is also present in bile duct epithelial cells and is secreted into bile. Its role in bile is unknown but it may be involved in innate immunity of the bowel muscosa.
14761964 DNA-PK/AREB6-like proteins play a central role in repression of basal hXOR activity
12774669 The activity of XO was determined in lymphocytes, eosinophils and blood serum in patients with bronchial asthma.
12637268 the molybdenum center of XOR is posttranslationally inactivated by oxygen metabolites in "normal" (21% O2) cell culture atmosphere and this inactivation is reversed in hypoxia and accounts for the apparent induction.
12168784 XDH may play a role in generating reactive oxygen species in oxidative eye injury

AA Sequence

MTADKLVFFVNGRKVVEKNADPETTLLAYLRRKLGLSGTKLGCGEGGCGACTVMLSKYDRLQNKIVHFSA      1 - 70
NACLAPICSLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTMEEIE     71 - 140
NAFQGNLCRCTGYRPILQGFRTFARDGGCCGGDGNNPNCCMNQKKDHSVSLSPSLFKPEEFTPLDPTQEP    141 - 210
IFPPELLRLKDTPRKQLRFEGERVTWIQASTLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVC    211 - 280
PAWIPELNSVEHGPDGISFGAACPLSIVEKTLVDAVAKLPAQKTEVFRGVLEQLRWFAGKQVKSVASVGG    281 - 350
NIITASPISDLNPVFMASGAKLTLVSRGTRRTVQMDHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSA    351 - 420
FKQASRREDDIAKVTSGMRVLFKPGTTEVQELALCYGGMANRTISALKTTQRQLSKLWKEELLQDVCAGL    421 - 490
AEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVLQKLGQENLEDKCGKLDPTFASATLLFQKDPPADVQL    491 - 560
FQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCDDIPRYENELSLRLVTSTRAHAKIKSIDTSEAKKVP    561 - 630
GFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIE    631 - 700
DAIKNNSFYGPELKIEKGDLKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVPKGEAGEMELFVSTQNT    701 - 770
MKTQSFVAKMLGVPANRIVVRVKRMGGGFGGKETRSTVVSTAVALAAYKTGRPVRCMLDRDEDMLITGGR    771 - 840
HPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFHMDNCYKIPNIRGTGRLCKTNLPSNT    841 - 910
AFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEGDLTHFNQKLEGFTLPRCWEECLASSQYHA    911 - 980
RKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFLNQAGALLHVYTDGSVLLTHGGTEMGQGLHTKMVQV    981 - 1050
ASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILKRLEPYKKKNPSGSWEDWVTA   1051 - 1120
AYMDTVSLSATGFYRTPNLGYSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPA   1121 - 1190
IDIGQVEGAFVQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKKAIYASKAV   1191 - 1260
GEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVTGVPENCKPWS   1261 - 1330
VRV                                                                      1331 - 1333
//

Text Mined References (113)

PMID Year Title
26863601 2016 Influences of XDH genotype by gene-gene interactions with SUCLA2 for thiopurine-induced leukopenia in Korean patients with Crohn's disease.
26426087 2015 Plasma Xanthine Oxidase Activity Is Predictive of Cardiovascular Disease in Patients with Chronic Kidney Disease, Independently of Uric Acid Levels.
26353179 2015 Association of ABCB1, ABCC5 and xanthine oxidase genetic polymorphisms with methotrexate adverse reactions in Mexican pediatric patients with ALL.
26342297 2015 Increase in thyroid stimulating hormone levels in patients with gout treated with inhibitors of xanthine oxidoreductase.
26239312 2015 Association between xanthine dehydrogenase tag single nucleotide polymorphisms and essential hypertension.
26119820 2015 Reactive oxygen species derived from xanthine oxidase interrupt dimerization of breast cancer resistance protein, resulting in suppression of uric acid excretion to the intestinal lumen.
26029922 2015 Autophagy-Regulated ROS from Xanthine Oxidase Acts as an Early Effector for Triggering Late Mitochondria-Dependent Apoptosis in Cathepsin S-Targeted Tumor Cells.
25800347 2015 Xanthine oxidoreductase regulates macrophage IL1? secretion upon NLRP3 inflammasome activation.
25582077 2015 Pleiotrophin-induced endothelial cell migration is regulated by xanthine oxidase-mediated generation of reactive oxygen species.
25537183 2015 Nitrite reductase activity of rat and human xanthine oxidase, xanthine dehydrogenase, and aldehyde oxidase: evaluation of their contribution to NO formation in vivo.
25501928 2015 Mechanistic insights into xanthine oxidoreductase from development studies of candidate drugs to treat hyperuricemia and gout.
25463089 2014 Xanthine oxidoreductase in atherosclerosis pathogenesis: not only oxidative stress.
25200751 2014 Crucial involvement of xanthine oxidase in the intracellular signalling networks associated with human myeloid cell function.
25185415 2014 The significance of serum xanthine oxidoreductase in patients with nonalcoholic fatty liver disease.
25044064 2014 The xanthine oxidase-NFAT5 pathway regulates macrophage activation and TLR-induced inflammatory arthritis.
24967004 2014 Xanthine oxidase activity is associated with risk factors for cardiovascular disease and inflammatory and oxidative status markers in metabolic syndrome: effects of a single exercise session.
24591758 2014 New markers: urine xanthine oxidase and myeloperoxidase in the early detection of urinary tract infection.
24506204 2014 Retinol oxidation to retinoic acid in human thyroid glandular cells.
24357442 2014 Uric acid and xanthine oxidoreductase in wound healing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24092361 2014 Ischemic heart diseases in Egypt: role of xanthine oxidase system and ischemia-modified albumin.
24024171 2013 Xanthine oxidoreductase-catalyzed reactive species generation: A process in critical need of reevaluation.
23892358 2013 Autophagy induced by cathepsin S inhibition induces early ROS production, oxidative DNA damage, and cell death via xanthine oxidase.
23819009 2013 The role of xanthine oxidase in hemodialysis-induced oxidative injury: relationship with nutritional status.
23597150 2013 Dependence of cell survival on correlative activities of xanthine oxidase and dihydopyrimidine dehydrogenase in human brain-derived cell culture.
23443115 2012 Identification of candidate polymorphisms on stress oxidative and DNA damage repair genes related with clinical outcome in breast cancer patients.
23340314 2013 Role of host xanthine oxidase in infection due to enteropathogenic and Shiga-toxigenic Escherichia coli.
23315321 2013 Genetic determinants of idiopathic noncirrhotic portal hypertension in HIV-infected patients.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23249873 2013 Multi-exon deletion in the XDH gene as a cause of classical xanthinuria.
23142692 Xanthine oxidase and lens oxidative stress markers in diabetic and senile cataract patients.
22981351 2012 Identification of a xanthinuria type I case with mutations of xanthine dehydrogenase in an Afghan child.
22678977 2012 Acquired xanthine dehydrogenase expression shortens survival in patients with resected adenocarcinoma of lung.
22495427 2012 Polymorphism of genes involved in purine metabolism (XDH, AOX1, MOCOS) in kidney transplant recipients receiving azathioprine.
22266962 2012 Hypoxanthine-xanthine oxidase down-regulates GLUT1 transcription via SIRT1 resulting in decreased glucose uptake in human placenta.
22168506 2012 Assessment of paraoxonase 1, xanthine oxidase and glutathione peroxidase activities, nitric oxide and thiol levels in women with polycystic ovary syndrome.
22105431 2012 Comparison of N-acetyltransferase-2 enzyme genotype-phenotype and xanthine oxidase enzyme activity between Swedes and Koreans.
22044687 2012 Decreased xanthine oxidoreductase (XOR) is associated with a worse prognosis in patients with serous ovarian carcinoma.
22029190 2011 Determination of oxygen derived free radicals producer (xanthine oxidase) and scavenger (paraoxonase1) enzymes and lipid parameters in different cancer patients.
21963464 2012 Novel mutations in xanthine dehydrogenase/oxidase cause severe hypouricemia: biochemical and molecular genetic analysis in two Czech families with xanthinuria type I.
21826556 2011 The aged-related increase in xanthine oxidase expression and activity in several tissues from mice is not shown in long-lived animals.
21775420 2011 Contribution of xanthine oxidoreductase to mammary epithelial and breast cancer cell differentiation in part modulates inhibitor of differentiation-1.
21644044 2012 The role of human xanthine oxidoreductase (HXOR), anti-HXOR antibodies, and microorganisms in synovial fluid of patients with joint inflammation.
21382276 Increased serum level of xanthine oxidoreductase in liver transplanted patients.
21059659 2011 Xanthine oxidoreductase promotes the inflammatory state of mononuclear phagocytes through effects on chemokine expression, peroxisome proliferator-activated receptor-{gamma} sumoylation, and HIF-1{alpha}.
20930425 2010 Functional characterization of genetic polymorphisms identified in the promoter region of the xanthine oxidase gene.
20570389 2011 Prognostic value of xanthine oxidoreductase expression in patients with non-small cell lung cancer.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20077140 2010 Xanthine dehydrogenase deficiency with novel sequence variations presenting as rheumatoid arthritis in a 78-year-old patient.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19765958 2010 Increased plasma xanthine oxidase activity is related to nuclear factor kappa beta activation and inflammatory markers in familial combined hyperlipidemia.
19693777 2009 Estradiol decreases xanthine dehydrogenase enzyme activity and protein expression in non-tumorigenic and malignant human mammary epithelial cells.
19628957 2009 The activities of paraoxonase, xanthine oxidase, adenosine deaminase and the level of nitrite in pseudoexfoliation syndrome.
19567609 2009 Increased xanthine oxidase activity in idiopathic pulmonary arterial hypertension.
19539448 2009 Exposure of human keratinocytes to ischemia, hyperglycemia and their combination induces oxidative stress via the enzymes inducible nitric oxide synthase and xanthine oxidase.
19531472 2009 The PRY/SPRY/B30.2 domain of butyrophilin 1A1 (BTN1A1) binds to xanthine oxidoreductase: implications for the function of BTN1A1 in the mammary gland and other tissues.
19505917 2009 Lead exposure, polymorphisms in genes related to oxidative stress, and risk of adult brain tumors.
19500084 2009 Novel pharmacogenetic markers for treatment outcome in azathioprine-treated inflammatory bowel disease.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19196876 2009 Increased xanthine oxidase in the skin of preeclamptic women.
18840375 2008 Six-month, prospective, longitudinal, open-label caffeine and dextromethorphan phenotyping study in children with growth hormone deficiency receiving recombinant human growth hormone replacement.
18823306 2008 Population pharmacokinetic and pharmacogenetic analysis of 6-mercaptopurine in paediatric patients with acute lymphoblastic leukaemia.
18821156 2008 Implication of xanthine oxidase in muscle oxidative stress in COPD patients.
18818408 2008 Mechanisms underlying erythrocyte and endothelial nitrite reduction to nitric oxide in hypoxia: role for xanthine oxidoreductase and endothelial nitric oxide synthase.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18775690 2008 Xanthine oxidase activity in patients with sepsis.
18772145 2008 Identification of proteins binding to E-Box/Ku86 sites and function of the tumor suppressor SAFB1 in transcriptional regulation of the human xanthine oxidoreductase gene.
18767115 2008 Migratory activity of human breast cancer cells is modulated by differential expression of xanthine oxidoreductase.
18712049 2008 Associations of hypertension and its complications with variations in the xanthine dehydrogenase gene.
18678861 2008 Role of xanthine oxidase activation and reduced glutathione depletion in rhinovirus induction of inflammation in respiratory epithelial cells.
18649358 2008 Replication of a genome-wide case-control study of esophageal squamous cell carcinoma.
18635756 2008 The effect of age and gender on pharmacokinetics, pharmacodynamics, and safety of febuxostat, a novel nonpurine selective inhibitor of xanthine oxidase.
18569334 2008 Xanthine dehydrogenase processes retinol to retinoic acid in human mammary epithelial cells.
18386220 2008 Xanthine oxidase interaction with vascular endothelial growth factor in human endothelial cell angiogenesis.
18300946 2008 Functional characterization of human xanthine oxidase allelic variants.
17906999 2007 Age-related increase in xanthine oxidase activity in human plasma and rat tissues.
17622935 2007 Xanthine oxidoreductase polymorphisms: influence in blood pressure and oxidative stress levels.
17523077 2007 The role of conjunctival epithelial cell xanthine oxidoreductase/xanthine oxidase in oxidative reactions on the ocular surface of dry eye patients with Sjögren's syndrome.
17301077 2007 Human xanthine oxidase changes its substrate specificity to aldehyde oxidase type upon mutation of amino acid residues in the active site: roles of active site residues in binding and activation of purine substrate.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16935971 2006 Decreased xanthine oxidoreductase is a predictor of poor prognosis in early-stage gastric cancer.
16758302 2006 Myeloperoxidase, xanthine oxidase and superoxide dismutase in the gastric mucosa of Helicobacter pylori positive and negative pediatric patients.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15451061 2004 Xanthine oxidoreductase is present in bile ducts of normal and cirrhotic liver.
14761964 2004 Characterization of proteins binding to E-box/Ku86 sites and function of Ku86 in transcriptional regulation of the human xanthine oxidoreductase gene.
14551354 2003 Mutational analysis of the xanthine dehydrogenase gene in a Turkish family with autosomal recessive classical xanthinuria.
12774669 2003 [Enzymes of purine metabolism of lymphocytes and eosinophiles in bronchial asthma].
12637268 2003 Posttranslational inactivation of human xanthine oxidoreductase by oxygen under standard cell culture conditions.
12456835 2002 Functional regulation of xanthine oxidoreductase expression and localization in the mouse mammary gland: evidence of a role in lipid secretion.
12168784 2002 Xanthine oxidoreductase and xanthine oxidase in human cornea.
12080414 2002 The physiology of endothelial xanthine oxidase: from urate catabolism to reperfusion injury to inflammatory signal transduction.
11993848 2002 Ultrastructural localization of xanthine oxidoreductase activity in isolated rat liver cells.
11960915 2002 Carcinogenic aristolochic acids upon activation by DT-diaphorase form adducts found in DNA of patients with Chinese herbs nephropathy.
11379872 2001 Identification of a new point mutation in the human xanthine dehydrogenase gene responsible for a case of classical type I xanthinuria.
11034305 2000 Nuclear factor Y activates the human xanthine oxidoreductase gene promoter.
10968141 1998 Detection of xanthine oxidase in human plasma.
10844591 2000 XDH gene mutation is the underlying cause of classical xanthinuria: a second report.
9388748 1997 Expression of xanthine oxidase activity in human endothelial cells as a function of cell density.
9153281 1997 Identification of two mutations in human xanthine dehydrogenase gene responsible for classical type I xanthinuria.
9023782 1997 Xanthine oxidase in human skeletal muscle following eccentric exercise: a role in inflammation.
8829220 Xanthine oxidase/dehydrogenase is present in human placenta.
8670112 1996 Cloning and expression in vitro of human xanthine dehydrogenase/oxidase.
8661045 1996 Molecular cloning and characterization of the human xanthine dehydrogenase gene (XDH).
8373410 1993 Regulation of xanthine dehydrogenase in rat liver in response to peroxisome proliferators.
8224915 1993 Cloning of the cDNA encoding human xanthine dehydrogenase (oxidase): structural analysis of the protein and chromosomal location of the gene.
8135849 1994 Molecular cloning, tissue expression of human xanthine dehydrogenase.
7956361 1995 The human gene for xanthine dehydrogenase (XDH) is localized on chromosome band 2q22.
7956358 1995 Mapping of the gene for human xanthine dehydrogenase (oxidase) (XDH) to band p23 of chromosome 2.
7829092 1994 Assignment of human xanthine dehydrogenase gene to chromosome 2p22.
7575623 1995 Molecular cloning, tissue expression of human xanthine dehydrogenase.