Property Summary

NCBI Gene PubMed Count 200
PubMed Score 2916.04
PubTator Score 254.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Cancer 2346 6.666 3.3
Epilepsy 346 0.0 4.0
Neurodegenerative disease 383 0.0 4.0

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 2.400 7.8e-04
osteosarcoma 1.299 6.0e-06
posterior fossa group B ependymoma 1.400 1.0e-09
astrocytoma 1.600 2.6e-03
medulloblastoma, large-cell -1.200 1.0e-03
tuberculosis 1.200 4.3e-06
intraductal papillary-mucinous adenoma (... -1.600 4.8e-04
intraductal papillary-mucinous carcinoma... -1.500 5.8e-03
adult high grade glioma -1.100 4.8e-03
group 4 medulloblastoma -1.200 1.2e-04
ovarian cancer -1.400 4.7e-08

Protein-protein Interaction (8)

Gene RIF (177)

PMID Text
26857392 Decreased WWOX expression may interfere with gemcitabine sensitivity, and allele-specific binding at rs11644332 might be a causative molecular mechanism behind the clinically observed associations.
26592150 Data suggest that Pc2- (polycomb repressive complex 2-) mediated SUMOylation of WWOX is essential for suppressive activity of WWOX in prostate cancer tumorigenesis.
26499798 WWOX played roles in metabolic regulation and controlling central nervous system development. [review]
26345274 WWOX mutation is associated with early infantile epileptic encephalopathy.
26166818 overexpression of WWOX attenuated miR-134 induced H69 small cell lung cancer cell growth, and promoted cell apoptosis
26120275 Compared to the controls, upregulation of WWOX and its Tyr33 phosphorylation was observed in the head region of all pterygium specimens. In the head and body of the pterygium specimens, WWOX expression was significantly higher than in the controls.
26041563 HGF and TGFbeta1 of bone-metastasis microenvironment acted co-ordinately, influencing non redundant pathways regulated by Twist program or Snail-transcription factor, with reversible MET switch
25892250 Results suggest that WWOX gene plays a role in the regulation of epithelial to mesenchymal transition process in endometrial cancer by controlling the expression of proteins associated with cell motility and suppressing mesenchymal markers.
25891642 The WWOX gene can downregulate the expression levels of cell cycle proteins cyclin E-CDK2 and cyclin D1-CDK4, which affects the cell cycle of ovarian cancer stem cells.
25720522 Hypermethylation of WWOX gene is associated with Epstein-Barr virus-associated gastric carcinomas.
25710931 Two and more tandem repeats cooperate in binding to their targets, in the well-characterized family of WWOX domains and their corresponding polyproline ligands.
25708809 miR-153 inhibited protein level of WWOX, a tumor suppressor and inhibitor of beta-catenin signaling, through targeting its 3'-untranslated region.
25703206 Study underscores a key role of allosteric communication in the ability of the WW2 orphan domain to chaperone physiological action of the WW1 domain within the context of the WW1-WW2 tandem module of WWOX.
25681467 WWOX gene is located in FRA16D, the highly affected chromosomal fragile site.
25678599 The inhibition of the transcriptional activity of BCL9-2 by WWOX and HDAC3 constitutes a new molecular mechanism and provides new insight for a broad range of cancers.
25662954 WWOX structure gives insights into the functional versatility of this key signaling protein with important implications on its biology.
25659037 WWOX inhibits prostate cancer progression through negatively regulating cyclin D1 in cell cycle lead to G1 arrest.
25627656 Tyrosine kinases play a role in regulating the WW proteins.
25612104 Inactivation of WWOX gene contributes to the progression of head and neck squamous cell carcinoma.
25595191 WWOX can be regarded as a prognostic marker and a candidate molecule for targeted cancer therapies.
25595186 Aberrant WWOX expression contributes to the altered metabolism in cancer.
25595185 WWOX is a member of a very interesting family of very large common fragile site genes and functions as a tumor suppressor involved in the development of many cancers.
25538133 WWOX is a tumor suppressor gene and is associated with FRA16D locus fragility.
25517572 Our data suggest that the loss genotypes of CNV-67048 in WWOX predispose their carriers to chronic obstructive pulmonary disease.
25502636 The role of WWOX in EHCC progression.
25491415 WWOX has many functions, and its deletion affects cellular metabolism and neoplastic progression.
25488911 There are multiple interactions between WWOX and oncogenic microbes.
25476151 There are roles of WWOX in the pathogenesis and endocrine therapy of breast cancer.
25432984 WWOX plays a role in the development, signaling pathway, prognosis, and treatment response of malignant glioma.
25416187 WWOX plays a critical role in normal central nervous system development and disease.
25411445 WWOX undoubtedly incriminated as a gene for recessive infantile epileptic encephalopathy.
25331887 These findings identify a novel role for the tumor suppressor WWOX and show that loss of WWOX expression may drive genomic instability
25245215 This review discusses the essential role of WWOX in tumor suppression and genomic stability and how its alteration contributes to cancer transformation. [review]
25168293 Down regulation of WWOX is involved in tumorigenesis in intrahepatic cholangiocarcinoma.
25051421 Glioblastoma cells with high WWOX expression had different transcription profiles. Wnt, TGFbeta, Notch and Hedgehog pathways were affected. WWOX-transfected cells had decreased proliferation and adhesion, and increased apoptosis.
25012504 WWOX expression is inversely correlated with GLUT1 levels in breast cancer samples highlighting WWOX as a modulator of cancer metabolism.
24969559 we show that WWOX required for stabilization of beta-catenin regulated by SENP2 in hepatocellular carcinoma cells
24968878 WWOX also plays a role as a tumor suppressor gene in multiple myeloma.
24938873 Data indicate increased WW-domain-containing oxidoreductase (WWOX) mRNA and protein expression in both colon cancer cell lines.
24899407 our findings suggest that the cytoplasmic protein COTE1 contributes to hepatocellular carcinoma tumorigenesis by regulating cell proliferation through the modulation of WWOX signaling
24871327 A strong genetic cosegregation between the WWOX gene and the low HDL-C trait observed genetic associations at the chr16q23-24 locus.
24585490 Loss genotypes of CNV-67048 in WWOX gene predispose their carriers to gliomas.
24550385 WW1 domain of WWOX provides a versatile platform that links WWOX with individual proteins associated with physiologically important networks
24520212 Loss of WWOX is closely related to genomic instability, tumorigenesis, cancer progression and therapy resistance. [review]
24503545 The expression of WOX1 on different types of nervous system tumors, including primary and metastatic tumors, is differential.
24473991 Loss of WWOX gene is associated with lung cancer.
24455756 no association between methylation status of WWOX promoter and its expression was observed
24393846 observed a physical association between Wwox and the Gli1 zinc-finger transcription factor involved in the hedgehog pathway
24369382 A missense mutation in WWOX was identified in autosomal recessive cerebellar ataxia patients with epilepsy and mental retardation.
24330824 increased RUNX2 and VEGFA gene copy numbers and elevation of their respective proteins in human OS
24330518 WWOX modulates SMAD3 signaling in breast cells via direct WW-domain mediated binding and potential cytoplasmic sequestration of SMAD3 protein.
24308844 Data suggest that WW2 domain of WWOX augments binding of WW1 domain of WWOX to PPXY motifs within intracellular domain of ErbB4 (receptor tyrosine-protein kinase erbB-4), implying that WW2 serves as chaperone within WW1-WW2 tandem module of WWOX.
24299313 Our results show that WWOX gene alteration is an early genetic alteration and may contribute to tumorigenesis of NPC.
24127039 The results have shown that the proliferation of the tumor was inhibited after delivery of WWOX, and the expressions of P73 and PUMA were upregulated in target tissues.
24126431 WWOX may be involved in endometrial cancer.
24044959 loss of WWOX expression not only resulted in glioma carcinogenesis, but also suppressed immune cell attack by inducing Fas/FasL mediated apoptotic signaling.
24008736 WWOX renders squamous cell carcinoma cells susceptible to methotrexate-induced apoptosis by dampening autophagy
23824713 Low WWOX expression is associated with tumorigenicity and metastasis of head and neck carcinoma.
23770367 WOX1 is involved in MMP9 induction, suggesting a novel role of WOX1 in Epstein-Barr virus-associated cancer progression
23765596 The WWOX gene spans the FRA16D common chromosomal fragile site and is able to suppress tumor growth.This gene not only contributes to the metabolic state of cells, its transcript levels are also linked to intracellular metabolic state.
23675860 loss of WWOX expression may be an early event in the pathogenesis of human astrocytoma.
23566416 Wwox localised at perinuclear level in neoplastic cells of bone metastasis, being almost absent in supportive cells, and Wwox-protein expression diminished in hypoxic-1833 cells.
23525648 WWOX exerts a role as a tumor suppressor gene in leukemia.
23525362 These data suggest that underexpression of WWOX is associated with cervical cancer development.
23446842 Studied interactions between WWOX and its associated factors p73 and p53 after WWOX overexpression was induced in Jurkat and K562 cells. Data revealed that p73 participates in WWOX-mediated apoptosis through binding with Wwox in the cytoplasm.
23381945 Our results indicate that patients with high expression of Wwox may gain more benefit from treatment with tamoxifen.
23339925 Copy number variations in WWOX were significantly associated with an increased lung cancer risk in Chinese patients.
23197378 WWOX may play an important role in gastric cardia adenocarcinoma especially in individuals with upper gastrointestinal cancer family history.
23030478 Downregulation of WWOX might lead to accumulation of cytoplasmic beta-catenin and the subsequent activation of Wnt/beta-catenin signaling pathway in hepatocellular carcinoma.
22898080 Data suggest that survival of glioblastoma cells depends on interaction between WOX1 and gain-of-function mutant of p53 (tumor protein p53); overexpression of WOX1 leads to apoptosis but only with gain-of-function mutant of p53 rather than wildtype.
22869583 Data indicate that the PVT1-NBEA and the PVT1-WWOX chimeric genes were associated with the expression of abnormal NBEA and WWOX.
22842668 in Wilms' tumors the WWOX expression levels are positively associated with the process of apoptosis, signal transduction through the ErbB4 pathway and EGFR and negatively with the regulation of the cell cycle (by cyclin E1 and D1)
22736928 introducing the WWOX gene into wild-type SMMC-7721 human hepatic carcinoma cell line suggests that WWOX can significantly inhibit cell proliferation and induce cell apoptosis.
22717556 The aim of the present paper was to evaluate Wwox and TAZ, nuclear effectors of Hippo-related pathways, were involved in E-cadherin expression in bone metastases specimens from breast cancer.
22693020 polymorphisms and haplotypes of WWOX gene are associated with the risk of lung cancer.
22634283 the WW2 domain likely serves as a chaperone to augment the physiological function of WW1 domain within WWOX.
22555346 our study confirmed again the tumor suppressor role of WWOX in human renal cell carcinoma.
22484428 WWOX induces apoptosis in A549 cells via the mitochondrial pathway.
22479346 Data identified IGF1, SLC4A4, WWOX, and SFMBT1 as hypertension susceptibility genes by gene based association scan and gene expression analysis.
22317867 loss of WWOX expression in epithelial ovarian carcinomas correlates with advanced International Federation of Gynecology and Obstetrics stages, and lymph node metastases
22248280 Hypermethylation and inactivation of WWOX gene is associated with bladder cancer.
22226915 overexpression of TMEM207 may facilitate invasive activity and metastasis of gastric signet-ring cell carcinoma, which possibly occur through binding to WWOX and attenuation of its function.
22213016 Protein and mRNA expression of WWOX was reduced in esophageal squamous cell carcinoma tumor tissues and was associated with loss of heterozygosity and hypermethylation of the gene.
22202011 review the potential mechanism by which WWOX/WOX1 may participate in the pathogenesis of AD with a focus on cell death signaling pathways in neurons
22193544 WWOX protein is likely to be involved in regulating GSK3beta activity, reducing the level of phosphorylated Tau, and subsequently promoting neurite outgrowth during neuron differentiation.
21983861 We conclude that mutations in critical region of the WWOX gene are frequent and may have an important role in breast carcinogenesis.
21767287 Data indicate that genetic variants near the KCNQ1 and MAF/WWOX genes are associated with reduced insulin secretion, and the PTPRD genetic variant appears to be associated with progression to diabetes in Han Chinese.
21685375 Using the Affymetrix 6.0 SNP array, the study shows that tumor suppressor genes FHIT and WWOX are deleted in primary effusion lymphoma cell lines.
21612698 WWOX exerts its antitumor effect against proliferation through inducing cell apoptosis in cholangiocarcinoma.
21520031 these findings suggest that the variant allele-282 could affect the biological function of WWOX, thereby predisposing individuals to thyroid cancer
21499303 the WWOX tumor suppressor gene has in preventing tumorigenesis in breast cancer
21476439 results show that the SDR domain of the WWOX protein has dehydrogenase activity and is reactive both in the presence of NAD+ and NADP+ for all examined steroid substrates
21466786 this study indicated that H. pylori infection promoted methylation of WWOX gene in gastric cancer.
21347750 A significantly better disease-free survival was observed among patients with tumours exhibiting high level of WWOX (hazard ratio = 0.39; p = 0.0452; Mantel-Cox log-rank test), but in multivariate analysis it was not an independent prognostic factor.
21332605 Aberrant WWOX transcription and decreased expression are frequent in salivary neoplasms and WWOX transcription is associated with p53 staining.
21276135 WWOX was identified as a Bmi1 target in small cell lung cancer cells
21165567 Molecular alterations in the tumour suppressor gene WWOX in benign and malignant bone related lesions of the jaws.
21138684 a negativie correlation between the expressions of STAT3 and WWOX, but no relationship was found between WWOX and c-myc
20942981 Results suggest that WWOX is a QTL for both TG and HDL.
20942981 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20737170 repression of WWOX expression may play an important role in stomach carcinogenesis.
20556583 Over-expression of WWOX gene could induce apoptosis and inhibit the growth of ovarian cancer cells.
20535528 The result of this study confirmed that WWOX is positively correlated with ErbB4 signaling pathway in glioblastoma multiforme.
20530675 WWOX reconstitution in osteosarcoma cells was associated with downregulation of RUNX2 levels and RUNX2 target genes, consistent with the ability of WWOX to suppress RUNX2 transactivation activity.
20510001 Absent/reduced FHIT and WWOX expression is associated with poor prognosis in hepatocellular carcinoma.
20480411 hypermethylation of WWOX gene promoter region and mutations in the gene is associated with non-small-cell lung cancer.
20401669 Reduced WWOX expression is associated with the basal-like subtype and a poor disease-free survival rate for breast cancer patients
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20367991 Reversing effect of exogenous WWOX gene expression on malignant phenotype of primary cultured lung carcinoma cells.
20146584 We offer a description of known WWOX functions
20074932 CGP samples demonstrated significant associations after Bonferroni correction between Isnp1, both tumour grade (p(corr)=0.033) and histology (p(corr)=0.046), Isnp8, tumour grade (p(corr)=0.032) and T1497G and progression-free survival (p(corr)=0.037).
20074932 Observational study of gene-disease association. (HuGE Navigator)
20060354 results suggest that, as for breast cancer, loss of Fhit and Wwox expression might have a role in the pathogenesis of basaloid differentiation in salivary gland neoplasms.
19957554 WWOX gene can suppress adhesion to fibronectin in ovarian cancer cells.
19950548 WWOX acts as an ovarian tumor suppressor by modulating the interaction between tumor cells and the extracellular matrix, decreasing integrin activity and adhesion of tumor cells to fibronectin.
19896763 loss of WWOX expression is an early event in the pathogenesis of osteosarcoma and the phenotypic results of its deletion do not imminently result in patient death.
19844255 Observational study of gene-disease association. (HuGE Navigator)
19708029 analysis of WWOX genomics, partners, and functions [review]
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19484134 Downregulation of C1q enhances prostate hyperplasia and cancerous formation due to failure of WOX1 activation
19465938 predominantly localized in the nucleus, in the cytoplasm compartment by WWOX. Our results indicate that WWOX is a novel inhibitor of the Wnt/beta-catenin pathway. WWOX would act, at least in part, by preventing the nuclear import of the Dvl proteins
19458077 A possible role for the loss of WWOX in the peritoneal dissemination of human ovarian cancer cells.
19434452 Loss of WWOX is associated with pancreatobiliary cancers.
19352382 Downregulation of WWOX expression by the WWOX regulatory region hypermethylation is critical for neoplastic transformation of pancreatic duct to pancreatic cancer.
19188760 Differential regulation of the WWOX gene plays an important role in the carcinogenesis of breast cancer, due partially to methylation of the WWOX DNA CpG islands.
19130459 Reduced expression levels of WWOX protein is associated with the pathogenesis of basal-like differentiation in breast cancer.
19087571 WWOX gene may be involved in cisplatin resistance in epithelial ovarian cancer.
19035517 Prostate cancer linkage to the same region of 16q23 has been observed by others and the region contains several strong candidate genes including the known prostate cancer tumor suppressor genes ATBF1 and WWOX.
18674750 there is an association between HDL-C and a WWOX variant with an allele-specific cis-regulatory function
18674750 Observational study of gene-disease association. (HuGE Navigator)
18629536 Loss of WWOX expression is associated with extrahepatic cholangiocarcinoma.
18620777 WWOX induces apoptosis and inhibits human hepatocellular carcinoma cell growth through a mechanism enhanced by JNK inhibition.
18487609 WWOX tumor suppressor is essential for postnatal survival and normal bone metabolism
18460020 down-modulation of Wwox expression is an early event and may be associated with the down-regulation of Smad4 protein levels during pancreatic duct carcinogenesis.
18452537 Loss of WWOX immunoexpression in patients with urinary bladder tumors strongly correlates with classical clinicopathological factors and appears to be a potential predictive marker of progressive disease.
18371080 Synthetic phospho-WOX1 peptide prevents neuronal death, suggesting its therapeutic role in mitigating the symptoms of Parkinson's disease.
18365142 Decreased expression of the WWOX tumour suppressor genemay be of importance for the development of human intracranial meningiomas
18273838 homozygous deletions can be markers of complex rearrangements that have targets outside the homozygous deletion itself and that the target of deletions in the FRA16D region is indeed WWOX, the common outcome being the removal of particular WWOX exons
18061530 results show that the WWOX gene alteration is an early genetic alteration and may contribute to oral carcinogenesis.
18047428 WWOX underexpression is an important step that might increase the vulnerability to the carcinogenesis process in papillary thyroid carcinomas.
17947476 Wwox and Ap2gamma emerge are tumor biomarkers that may be superior to PR and Her2 in predicting tamoxifen response
17909041 Expression of Wwox is associated with ErbB4 expression and that their coexpression has prognostic significance in breast cancer.
17704139 Wwox reduces ErbB2 protein expression in vitro and expression of Wwox protein inversely correlates with expression of ErbB2 protein in prostate cancer tissues.
17609426 Gene mapping and expression analysis of 16q loss of heterozygosity identifies WWOX and CYLD as being important in determining clinical outcome in multiple myeloma.
17289881 loss of WWOX expression plays different roles in tumorigenesis of distinct histotypes and subtypes of NSCLC and is related to high aggressiveness (G3; high proliferating activity) of tumors
17200365 overexpression of exogenous Wwox inhibits breast cancer cell growth in vitro and in vivo
17178850 Novel functional cross-talk between c-Jun transcription factor and WWOX tumor suppressor protein
17163164 This gene encodes a protein that contains two WW domains responsible of protein-protein interactions and a short-chain dehydrogenase (SDR) domain likely involved in sex steroid metabolism
16941225 comprehensive analysis of WWOX protein expression in normal tissues was performed by means of immunohistochemistry
16818616 WWOX overexpression in prostate cancer cells suppressed colony growth and induced apoptosis. Data are consistent with a role for WWOX as a prostate cancer tumor suppressor.
16438931 PKA-mediated phosphorylation of ezrin is essential and sufficient for the apical localization of WWOX protein as disruption of ezrin-WWOX interaction eliminated the apical localization of WWOX
16360296 WWOX may be involved in steroid (estrogens) metabolism and signaling pathways. WWOX can be considered as a new target for gene therapy development due to the association of high WWOX expression with improved disease free survival.
16288044 Activated tyrosine kinase Ack1 promotes prostate tumorigenesis by tyrosine phosphorylation of tumor suppressor Wwox at Tyr-287. It leads to polyubiquitination and degradation.
16219768 WOX1 plays a critical role in conferring cellular sensitivity to apoptotic stress and Tyr33 phosphorylation in WOX1 is essential for binding and stabilizing Ser46-phosphorylated p53
16152610 WWOX gene is frequently altered in oral squamous cell carcinomas and may contribute to the carcinogenesis processes in oral cancer
16115915 WOX1 (also named WWOX) is essential for UVB-induced apoptosis and likely to be involved in the terminal differentiation of normal keratinocytes.
16061658 WWOX antagonizes the function of YAP by competing for interaction with ErbB-4 and other targets and thus affect its transcriptional activity.
15998374 Reduced Wwox expression in invasive ductal carcinoma in-situ (DCIS) breast cancer was associated, which may contribute to the high-grade DCIS-invasive tumor pathway.
15982416 WWOX protein expression is highly variable among ovarian carcinoma histotypes and may have a role in disease progression
15798093 UV-induced alterations of the FHIT and WWOX fragile site gene expression are involved at least partially in the checkpoint function of DNA damage
15674328 WWOX hypermethylation analys9s could enrich a panel of DNA methylation markers in breast, lung and bladder cancer.
15580310 sex steroid hormone-induced activation of WOX1 and WOX2 is independent of estrogen receptor and androgen receptor
15548692 Wwox expression triggers redistribution of nuclear AP-2gamma to the cytoplasm, hence suppressing its transactivating function
15266310 WWOX gene is frequently altered in hepatocelluarl carcinoma; this gene may be implicated in hepatocarcinogenesis
15131042 Results indicate that alterations of the WWOX gene may be involved quite frequently in gastric tumorigenesis and could be used in future studies to develop diagnostic and targeted therapy of stomach cancer.
15126504 WW domain-containing oxidoreductase downregulation induces Tau phosphorylation in vitro
15073846 Wwox has an important and complex association with steroid hormone expression and breast carcinogenesis
15073125 the WWOX gene may play an important role in pancreatic tumor development
15070730 Wwox expression triggers redistribution of nuclear p73 to the cytoplasm and, hence, suppresses its transcriptional activity.
15064722 These studies demonstrate that WWOX contains a Group I WW domain that binds known cellular proteins containing the specific ligand PPXY.
15044096 The data suggest that E2F-1 overexpression plays a role in suppression of tumor, at least in part trough transcriptional regulation of FHIT and relevant activation of WWOX.
15026124 Expression and distribution of WOX1 in developing and adult murine nervous system. Potential role of WOX1 in the neuronal differentiation.
14526170 Identification of WWOX as the target of FRA16D and ectopic WWOX expression inhibits tumor growth.
12514174 phosphorylation of JNK1 and WOX1 is necessary for their physical interaction and functional antagonism
11956080 Alteration and inactivation of the WWOX gene may play a role in esophageal squamous cell carcinogenesis.
11719429 WWOX, the FRA16D gene, behaves as a suppressor of tumor growth.

AA Sequence

MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDEN      1 - 70
GQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFET     71 - 140
AKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCN    141 - 210
AATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRL    211 - 280
SPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSNIHRSWWVYTLLFTLARPFTK    281 - 350
SMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG          351 - 414
//

Text Mined References (204)

PMID Year Title
26857392 2016 Relevance of Sp Binding Site Polymorphism in WWOX for Treatment Outcome in Pancreatic Cancer.
26592150 2015 Pc2-mediated SUMOylation of WWOX is essential for its suppression of DU145 prostate tumorigenesis.
26499798 2015 Pleiotropic Functions of Tumor Suppressor WWOX in Normal and Cancer Cells.
26345274 2015 Severe CNS involvement in WWOX mutations: Description of five new cases.
26166818 2015 MicroRNA-134 regulates lung cancer cell H69 growth and apoptosis by targeting WWOX gene and suppressing the ERK1/2 signaling pathway.
26120275 2015 Expression of WW domain-containing oxidoreductase WWOX in pterygium.
26041563 2015 HGF and TGF?1 differently influenced Wwox regulatory function on Twist program for mesenchymal-epithelial transition in bone metastatic versus parental breast carcinoma cells.
25892250 2015 The role of WWOX tumor suppressor gene in the regulation of EMT process via regulation of CDH1-ZEB1-VIM expression in endometrial cancer.
25891642 2015 Effect of the WWOX gene on the regulation of the cell cycle and apoptosis in human ovarian cancer stem cells.
25720522 2015 Aberrant gene promoter methylation of p16, FHIT, CRBP1, WWOX, and DLC-1 in Epstein-Barr virus-associated gastric carcinomas.
25710931 2015 Versatile communication strategies among tandem WW domain repeats.
25708809 2015 MicroRNA-153 promotes Wnt/?-catenin activation in hepatocellular carcinoma through suppression of WWOX.
25703206 2015 Allostery mediates ligand binding to WWOX tumor suppressor via a conformational switch.
25681467 2015 Alteration of WWOX in human cancer: a clinical view.
25678599 2015 The Tumor-Suppressor WWOX and HDAC3 Inhibit the Transcriptional Activity of the ?-Catenin Coactivator BCL9-2 in Breast Cancer Cells.
25662954 2015 Structural insights into the functional versatility of WW domain-containing oxidoreductase tumor suppressor.
25659037 2015 WWOX suppresses prostate cancer cell progression through cyclin D1-mediated cell cycle arrest in the G1 phase.
25627656 2015 Tyrosine phosphorylation of WW proteins.
25612104 2015 Epigenetic and genetic alterations affect the WWOX gene in head and neck squamous cell carcinoma.
25595191 2015 Regulation of cell signaling and apoptosis by tumor suppressor WWOX.
25595186 2015 WWOX, the chromosomal fragile site FRA16D spanning gene: its role in metabolism and contribution to cancer.
25595185 2015 WWOX, large common fragile site genes, and cancer.
25538133 2015 WWOX: a fragile tumor suppressor.
25517572 2015 The Functional Copy Number Variation-67048 in WWOX Contributes to Increased Risk of COPD in Southern and Eastern Chinese.
25502636 2014 WWOX suppresses cell growth and induces cell apoptosis via inhibition of P38 nuclear translocation in cholangiocarcinoma.
25491415 2015 The tumor suppressor WW domain-containing oxidoreductase modulates cell metabolism.
25488911 2015 Strategies of oncogenic microbes to deal with WW domain-containing oxidoreductase.
25476151 2015 Roles of the WWOX in pathogenesis and endocrine therapy of breast cancer.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
25432984 2015 Role of WW domain proteins WWOX in development, prognosis, and treatment response of glioma.
25416187 2015 The fragile site WWOX gene and the developing brain.
25411445 2015 WWOX-related encephalopathies: delineation of the phenotypical spectrum and emerging genotype-phenotype correlation.
25331887 2014 WWOX, the common fragile site FRA16D gene product, regulates ATM activation and the DNA damage response.
25245215 2014 The common fragile site FRA16D gene product WWOX: roles in tumor suppression and genomic stability.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25168293 2015 Association of downregulation of WWOX with poor prognosis in patients with intrahepatic cholangiocarcinoma after curative resection.
25051421 2014 WWOX modulates the gene expression profile in the T98G glioblastoma cell line rendering its phenotype less malignant.
25012504 2014 Tumor suppressor WWOX regulates glucose metabolism via HIF1? modulation.
24969559 2014 SENP2 regulated the stability of ?-catenin through WWOX in hepatocellular carcinoma cell.
24968878 2014 The WWOX gene inhibits the growth of U266 multiple myeloma cells by triggering the intrinsic apoptotic pathway.
24938873 2014 Diverse effect of WWOX overexpression in HT29 and SW480 colon cancer cell lines.
24929828 2014 Genome-wide association analysis identifies six new loci associated with forced vital capacity.
24899407 2014 Upregulation of the putative oncogene COTE1 contributes to human hepatocarcinogenesis through modulation of WWOX signaling.
24871327 2014 The WWOX gene modulates high-density lipoprotein and lipid metabolism.
24648952 2013 Methylation status of WWOX gene promoter CpG islands in epithelial ovarian cancer and its clinical significance.
24585490 2014 Association study of a functional copy number variation in the WWOX gene with risk of gliomas among Chinese people.
24550385 2014 Characterizing WW domain interactions of tumor suppressor WWOX reveals its association with multiprotein networks.
24520212 2014 Common Chromosomal Fragile Site Gene WWOX in Metabolic Disorders and Tumors.
24503545 2013 Expression of WW domain-containing oxidoreductase WOX1 in human nervous system tumors.
24473991 2014 New syngeneic inflammatory-related lung cancer metastatic model harboring double KRAS/WWOX alterations.
24456803 2014 The supposed tumor suppressor gene WWOX is mutated in an early lethal microcephaly syndrome with epilepsy, growth retardation and retinal degeneration.
24455756 2014 The correlation analysis of WWOX expression and cancer related genes in neuroblastoma- a real time RT-PCR study.
24393846 2014 Wwox suppresses breast cancer cell growth through modulation of the hedgehog-GLI1 signaling pathway.
24369382 2014 The tumour suppressor gene WWOX is mutated in autosomal recessive cerebellar ataxia with epilepsy and mental retardation.
24330824 2013 Correlation of WWOX, RUNX2 and VEGFA protein expression in human osteosarcoma.
24330518 2013 The cancer gene WWOX behaves as an inhibitor of SMAD3 transcriptional activity via direct binding.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
24308844 2013 Molecular origin of the binding of WWOX tumor suppressor to ErbB4 receptor tyrosine kinase.
24299313 2014 Molecular alterations of the WWOX gene in nasopharyngeal carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24127039 2014 WW domain containing oxidoreductase induces apoptosis in gallbladder-derived malignant cell by upregulating expression of P73 and PUMA.
24126431 2013 The WWOX tumor suppressor gene in endometrial adenocarcinoma.
24044959 Upregulation of tumor suppressor WWOX promotes immune response in glioma.
24008736 2013 WWOX suppresses autophagy for inducing apoptosis in methotrexate-treated human squamous cell carcinoma.
23824713 2014 miR-134 induces oncogenicity and metastasis in head and neck carcinoma through targeting WWOX gene.
23770367 2013 WW domain-containing oxidoreductase is involved in upregulation of matrix metalloproteinase 9 by Epstein-Barr virus latent membrane protein 2A.
23765596 2013 Common chromosomal fragile site FRA16D tumor suppressor WWOX gene expression and metabolic reprograming in cells.
23675860 2013 Reduced WWOX protein expression in human astrocytoma.
23568457 2013 Genetic variants associated with disordered eating.
23566416 2013 Hypoxia inducible factor-1 is activated by transcriptional co-activator with PDZ-binding motif (TAZ) versus WWdomain-containing oxidoreductase (WWOX) in hypoxic microenvironment of bone metastasis from breast cancer.
23525648 2013 The role of the WWOX gene in leukemia and its mechanisms of action.
23525362 2013 WWOX induces apoptosis and inhibits proliferation in cervical cancer and cell lines.
23446842 2013 p73 participates in WWOX-mediated apoptosis in leukemia cells.
23381945 2013 Wwox expression may predict benefit from adjuvant tamoxifen in randomized breast cancer patients.
23339925 2013 A functional copy number variation in the WWOX gene is associated with lung cancer risk in Chinese.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23197378 2013 Genetic and epigenetic alterations of WWOX in the development of gastric cardia adenocarcinoma.
23030478 2013 The expression and significance of WWOX and ?-catenin in hepatocellular carcinoma.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22898080 2012 Overexpression of WW domain-containing oxidoreductase WOX1 preferentially induces apoptosis in human glioblastoma cells harboring mutant p53.
22869583 2012 Frequent PVT1 rearrangement and novel chimeric genes PVT1-NBEA and PVT1-WWOX occur in multiple myeloma with 8q24 abnormality.
22842668 2012 Genetic alterations of WWOX in Wilms' tumor are involved in its carcinogenesis.
22736928 2012 WWOX induces apoptosis and inhibits proliferation of human hepatoma cell line SMMC-7721.
22717556 2013 Bone metastatic process of breast cancer involves methylation state affecting E-cadherin expression through TAZ and WWOX nuclear effectors.
22693020 2013 The polymorphisms and haplotypes of WWOX gene are associated with the risk of lung cancer in southern and eastern Chinese populations.
22634283 2012 Biophysical basis of the binding of WWOX tumor suppressor to WBP1 and WBP2 adaptors.
22555346 2013 WWOX protein expression varies among RCC histotypes and downregulation of WWOX protein correlates with less-favorable prognosis in clear RCC.
22484428 2012 WWOX-mediated apoptosis in A549 cells mainly involves the mitochondrial pathway.
22479346 2012 Identification of IGF1, SLC4A4, WWOX, and SFMBT1 as hypertension susceptibility genes in Han Chinese with a genome-wide gene-based association study.
22317867 2012 Aberrant expression of WWOX protein in epithelial ovarian cancer: a clinicopathologic and immunohistochemical study.
22248280 2012 Cigarette smoking extract causes hypermethylation and inactivation of WWOX gene in T-24 human bladder cancer cells.
22226915 2012 A WWOX-binding molecule, transmembrane protein 207, is related to the invasiveness of gastric signet-ring cell carcinoma.
22213016 2013 Decreased expression of WWOX in the development of esophageal squamous cell carcinoma.
22202011 2012 Role of WWOX/WOX1 in Alzheimer's disease pathology and in cell death signaling.
22193544 2012 WW domain-containing oxidoreductase promotes neuronal differentiation via negative regulation of glycogen synthase kinase 3?.
22158537 2011 Meta-analysis of genome-wide association studies identifies eight new loci for type 2 diabetes in east Asians.
21983861 2012 Genetic alterations of the WWOX gene in breast cancer.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21767287 2012 Replication of genome-wide association signals of type 2 diabetes in Han Chinese in a prospective cohort.
21685375 2011 Tumor suppressor genes FHIT and WWOX are deleted in primary effusion lymphoma (PEL) cell lines.
21612698 2011 [Expression of WW domain containing oxidoreductase gene in cholangiocarcinoma and its effect on the biological behavior of cancer cell line RBE].
21552555 2011 A genome-wide association study on obesity and obesity-related traits.
21520031 2011 Evidences that the polymorphism Pro-282-Ala within the tumor suppressor gene WWOX is a new risk factor for differentiated thyroid carcinoma.
21499303 2011 Wwox inactivation enhances mammary tumorigenesis.
21476439 WWOX oxidoreductase--substrate and enzymatic characterization.
21466786 2011 Helicobacter pylori infection promotes methylation of WWOX gene in human gastric cancer.
21347750 2011 WWOX expression in colorectal cancer--a real-time quantitative RT-PCR study.
21332605 2011 Impact of WWOX alterations on p73, ?Np73, p53, cell proliferation and DNA ploidy in salivary gland neoplasms.
21276135 2011 Bmi1 regulates cell fate via tumor suppressor WWOX repression in small-cell lung cancer cells.
21165567 2011 Evidence of molecular alterations in the tumour suppressor gene WWOX in benign and malignant bone related lesions of the jaws.
21138684 2010 [The expressions of STAT3, WWOX and c-myc in human non small cell lung cancer tissue and correlativity analysis].
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
20942981 2010 WWOX gene is associated with HDL cholesterol and triglyceride levels.
20923822 2010 Radiation pharmacogenomics: a genome-wide association approach to identify radiation response biomarkers using human lymphoblastoid cell lines.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20737170 2010 Loss of WW domain-containing oxidoreductase expression in the progression and development of gastric carcinoma: clinical and histopathologic correlations.
20556583 2010 Cloning of WWOX gene and its growth-inhibiting effects on ovarian cancer cells.
20535528 2011 Molecular analysis of WWOX expression correlation with proliferation and apoptosis in glioblastoma multiforme.
20530675 2010 Frequent attenuation of the WWOX tumor suppressor in osteosarcoma is associated with increased tumorigenicity and aberrant RUNX2 expression.
20510001 2010 [The relationship between FHIT and WWOX expression and clinicopathological features in hepatocellular carcinoma].
20480411 2010 WWOX gene may contribute to progression of non-small-cell lung cancer (NSCLC).
20401669 2011 The prognostic significance of WWOX expression in patients with breast cancer and its association with the basal-like phenotype.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20367991 2010 Reversing effect of exogenous WWOX gene expression on malignant phenotype of primary cultured lung carcinoma cells.
20146584 2010 WWOX gene and gene product: tumor suppression through specific protein interactions.
20074932 2010 WWOX tumour suppressor gene polymorphisms and ovarian cancer pathology and prognosis.
20060354 2010 Study of FHIT and WWOX expression in mucoepidermoid carcinoma and adenoid cystic carcinoma of salivary gland.
19957554 2009 [Effect of WWOX gene on the attachment and adhesion of ovarian cancer cells].
19950548 2009 [Effects of WWOX on ovarian cancer cell attachment in vitro].
19896763 2010 Deletion of the WWOX gene and frequent loss of its protein expression in human osteosarcoma.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19708029 2009 WWOX: its genomics, partners, and functions.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
19484134 2009 Complement C1q activates tumor suppressor WWOX to induce apoptosis in prostate cancer cells.
19465938 2009 Inhibition of the Wnt/beta-catenin pathway by the WWOX tumor suppressor protein.
19458077 2009 WWOX gene expression abolishes ovarian cancer tumorigenicity in vivo and decreases attachment to fibronectin via integrin alpha3.
19434452 2009 Coordinate loss of fragile gene expression in pancreatobiliary cancers: correlations among markers and clinical features.
19366691 2009 Transforming growth factor beta1 signaling via interaction with cell surface Hyal-2 and recruitment of WWOX/WOX1.
19352382 2009 Hypermethylation-mediated reduction of WWOX expression in intraductal papillary mucinous neoplasms of the pancreas.
19188760 2009 Association between CpG island methylation of the WWOX gene and its expression in breast cancers.
19130459 2009 Fragile histidine triad protein, WW domain-containing oxidoreductase protein Wwox, and activator protein 2gamma expression levels correlate with basal phenotype in breast cancer.
19087571 2008 [Suppression of WWOX gene by RNA interference reverses platinum resistance acquired in SKOV3/SB cells].
19035517 2009 Genome-wide linkage scan for prostate cancer susceptibility from the University of Michigan Prostate Cancer Genetics Project: suggestive evidence for linkage at 16q23.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18674750 2008 WW-domain-containing oxidoreductase is associated with low plasma HDL-C levels.
18629536 2009 Loss of WWOX expression in human extrahepatic cholangiocarcinoma.
18620777 2008 The JNK inhibitor SP600129 enhances apoptosis of HCC cells induced by the tumor suppressor WWOX.
18487609 2008 The WWOX tumor suppressor is essential for postnatal survival and normal bone metabolism.
18460020 2008 Role of the WWOX gene, encompassing fragile region FRA16D, in suppression of pancreatic carcinoma cells.
18452537 2008 Low levels of WWOX protein immunoexpression correlate with tumour grade and a less favourable outcome in patients with urinary bladder tumours.
18371080 2008 MPP+-induced neuronal death in rats involves tyrosine 33 phosphorylation of WW domain-containing oxidoreductase WOX1.
18365142 2008 Microarray analysis reveals down-regulation of the tumour suppressor gene WWOX and up-regulation of the oncogene TYMS in intracranial sporadic meningiomas.
18273838 2008 Homozygous deletions may be markers of nearby heterozygous mutations: The complex deletion at FRA16D in the HCT116 colon cancer cell line removes exons of WWOX.
18061530 2008 Molecular alterations in the tumor suppressor gene WWOX in oral leukoplakias.
18047428 2007 Association between decreased WWOX protein expression and thyroid cancer development.
17947476 2007 Wwox and Ap2gamma expression levels predict tamoxifen response.
17909041 2007 Association of Wwox with ErbB4 in breast cancer.
17704139 2007 Wwox suppresses prostate cancer cell growth through modulation of ErbB2-mediated androgen receptor signaling.
17609426 2007 Gene mapping and expression analysis of 16q loss of heterozygosity identifies WWOX and CYLD as being important in determining clinical outcome in multiple myeloma.
17289881 2007 WWOX expression in different histologic types and subtypes of non-small cell lung cancer.
17200365 2007 Inhibition of breast cancer cell growth in vitro and in vivo: effect of restoration of Wwox expression.
17178850 2006 Physical association with WWOX suppresses c-Jun transcriptional activity.
17163164 2006 WWOX, a chromosomal fragile site gene and its role in cancer.
16941225 2006 WWOX protein expression in normal human tissues.
16818616 2006 A role for the WWOX gene in prostate cancer.
16438931 2006 PKA-mediated protein phosphorylation regulates ezrin-WWOX interaction.
16360296 2006 WWOX--the FRA16D cancer gene: expression correlation with breast cancer progression and prognosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16288044 2005 Activated tyrosine kinase Ack1 promotes prostate tumorigenesis: role of Ack1 in polyubiquitination of tumor suppressor Wwox.
16223882 2005 WWOX gene restoration prevents lung cancer growth in vitro and in vivo.
16219768 2005 WOX1 is essential for tumor necrosis factor-, UV light-, staurosporine-, and p53-mediated cell death, and its tyrosine 33-phosphorylated form binds and stabilizes serine 46-phosphorylated p53.
16152610 2006 Characterization of the tumor suppressor gene WWOX in primary human oral squamous cell carcinomas.
16115915 2005 WOX1 is essential for UVB irradiation-induced apoptosis and down-regulated via translational blockade in UVB-induced cutaneous squamous cell carcinoma in vivo.
16061658 2005 WW domain-containing proteins, WWOX and YAP, compete for interaction with ErbB-4 and modulate its transcriptional function.
15998374 2005 Concordant loss of fragile gene expression early in breast cancer development.
15982416 2005 WWOX protein expression varies among ovarian carcinoma histotypes and correlates with less favorable outcome.
15798093 2005 Components of DNA damage checkpoint pathway regulate UV exposure-dependent alterations of gene expression of FHIT and WWOX at chromosome fragile sites.
15674328 2005 Fragile genes as biomarkers: epigenetic control of WWOX and FHIT in lung, breast and bladder cancer.
15580310 2005 17beta-Estradiol upregulates and activates WOX1/WWOXv1 and WOX2/WWOXv2 in vitro: potential role in cancerous progression of breast and prostate to a premetastatic state in vivo.
15548692 2004 Physical and functional interactions between the Wwox tumor suppressor protein and the AP-2gamma transcription factor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15266310 2004 Frequent downregulation and loss of WWOX gene expression in human hepatocellular carcinoma.
15131042 2004 Loss of WWOX expression in gastric carcinoma.
15126504 2004 Down-regulation of WW domain-containing oxidoreductase induces Tau phosphorylation in vitro. A potential role in Alzheimer's disease.
15073846 2004 The fragile genes FHIT and WWOX are inactivated coordinately in invasive breast carcinoma.
15073125 2004 The tumor suppressor gene WWOX at FRA16D is involved in pancreatic carcinogenesis.
15070730 2004 Functional association between Wwox tumor suppressor protein and p73, a p53 homolog.
15064722 2004 WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins.
15044096 2004 Effect of exogenous E2F-1 on the expression of common chromosome fragile site genes, FHIT and WWOX.
15026124 2004 Expression of WW domain-containing oxidoreductase WOX1 in the developing murine nervous system.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695174 2003 An opposing view on WWOX protein function as a tumor suppressor.
14526170 2003 WWOX, the common chromosomal fragile site, FRA16D, cancer gene.
12514174 2003 JNK1 physically interacts with WW domain-containing oxidoreductase (WOX1) and inhibits WOX1-mediated apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11956080 2002 Genetic alterations of the tumor suppressor gene WWOX in esophageal squamous cell carcinoma.
11719429 2001 WWOX, the FRA16D gene, behaves as a suppressor of tumor growth.
11572989 2001 WWOX: a candidate tumor suppressor gene involved in multiple tumor types.
11058590 2001 Hyaluronidase induction of a WW domain-containing oxidoreductase that enhances tumor necrosis factor cytotoxicity.
10861292 2000 Common chromosomal fragile site FRA16D sequence: identification of the FOR gene spanning FRA16D and homozygous deletions and translocation breakpoints in cancer cells.
10786676 2000 WWOX, a novel WW domain-containing protein mapping to human chromosome 16q23.3-24.1, a region frequently affected in breast cancer.