Property Summary

NCBI Gene PubMed Count 78
PubMed Score 92.80
PubTator Score 97.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.500 5.6e-04
Astrocytoma, Pilocytic -1.200 1.1e-03
atypical teratoid / rhabdoid tumor 1.300 2.2e-06
Breast cancer -1.300 8.3e-14
colon cancer 1.200 6.2e-03
ependymoma 1.300 3.2e-02
glioblastoma -1.100 3.2e-03
group 3 medulloblastoma -1.700 2.8e-04
interstitial cystitis -1.700 6.0e-03
medulloblastoma, large-cell 1.400 1.8e-04
nephrosclerosis -1.153 9.3e-03
osteosarcoma 1.073 1.1e-05
ovarian cancer 2.400 8.3e-05
pancreatic cancer -1.100 3.8e-02
primary pancreatic ductal adenocarcinoma -1.412 6.7e-03
primitive neuroectodermal tumor -1.100 3.8e-03
psoriasis -1.500 9.1e-05
spina bifida -2.271 3.6e-02

Gene RIF (78)

AA Sequence

MPRPELPLPEGWEEARDFDGKVYYIDHTNRTTSWIDPRDRYTKPLTFADCISDELPLGWEEAYDPQVGDY      1 - 70
FIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVAQEALSAQKEIYQVKQQRLELAQQEYQQLHAVWEHKLG     71 - 140
SQVSLVSGSSSSSKYDPEILKAEIATAKSRVNKLKREMVHLQHELQFKERGFQTLKKIDKKMSDAQGSYK    141 - 210
LDEAQAVLRETKAIKKAITCGEKEKQDLIKSLAMLKDGFRTDRGSHSDLWSSSSSLESSSFPLPKQYLDV    211 - 280
SSQTDISGSFGINSNNQLAEKVRLRLRYEEAKRRIANLKIQLAKLDSEAWPGVLDSERDRLILINEKEEL    281 - 350
LKEMRFISPRKWTQGEVEQLEMARKRLEKDLQAARDTQSKALTERLKLNSKRNQLVRELEEATRQVATLH    351 - 420
SQLKSLSSSMQSLSSGSSPGSLTSSRGSLVASSLDSSTSASFTDLYYDPFEQLDSELQSKVEFLLLEGAT    421 - 490
GFRPSGCITTIHEDEVAKTQKAEGGGRLQALRSLSGTPKSMTSLSPRSSLSSPSPPCSPLMADPLLAGDA    491 - 560
FLNSLEFEDPELSATLCELSLGNSAQERYRLEEPGTEGKQLGQAVNTAQGCGLKVACVSAAVSDESVAGD    561 - 630
SGVYEASVQRLGASEAAAFDSDESEAVGATRIQIALKYDEKNKQFAILIIQLSNLSALLQQQDQKVNIRV    631 - 700
AVLPCSESTTCLFRTRPLDASDTLVFNEVFWVSMSYPALHQKTLRVDVCTTDRSHLEECLGGAQISLAEV    701 - 770
CRSGERSTRWYNLLSYKYLKKQSRELKPVGVMAPASGPASTDAVSALLEQTAVELEKRQEGRSSTQTLED    771 - 840
SWRYEETSENEAVAEEEEEEVEEEEGEEDVFTEKASPDMDGYPALKVDKETNTETPAPSPTVVRPKDRRV    841 - 910
GTPSQGPFLRGSTIIRSKTFSPGPQSQYVCRLNRSDSDSSTLSKKPPFVRNSLERRSVRMKRPSSVKSLR    911 - 980
SERLIRTSLDLELDLQATRTWHSQLTQEISVLKELKEQLEQAKSHGEKELPQWLREDERFRLLLRMLEKR    981 - 1050
QMDRAEHKGELQTDKMMRAAAKDVHRLRGQSCKEPPEVQSFREKMAFFTRPRMNIPALSADDV          1051 - 1113
//

Text Mined References (85)

PMID Year Title