Property Summary

NCBI Gene PubMed Count 11
PubMed Score 95.08
PubTator Score 31.10

Knowledge Summary


No data available


  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.600 1.0e-03
osteosarcoma 1.279 1.8e-03
pancreatic carcinoma 1.600 1.0e-03
ovarian cancer -1.900 9.6e-05
chronic rhinosinusitis -1.249 4.4e-02
cystic fibrosis and chronic rhinosinusit... -1.081 4.2e-02

Pathway (1)

Gene RIF (4)

27100087 WRB gene contains a maternally imprinted differentially methylated region (DMR). The maternally inherited 5mCpG imprints at the WRB DMR are uncoupled from the parental allele expression of WRB and ten neighboring genes in twelve biosamples (brain, blood, fallopian tube, fetal large and small intestine, hESCs, large airway epithelial cells, thyroid, muscle, epidermal keratinocytes, ovary, skin, and testis).
23041287 Results indicate calcium-modulating cyclophilin ligand (CAML) and WRB as components of the TRC40 receptor complex and a crucial mechanism for driving ER membrane insertion of TA proteins in mammalian cells.
21444755 The coiled-coil domain of WRB is the binding site for TRC40/Asna1.
20200978 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

RLVAFPTRVAGGVGITCWILVCNKVVAIVLHPFS                                        141 - 174

Text Mined References (12)

PMID Year Title
27100087 2016 Trisomy 21 Alters DNA Methylation in Parent-of-Origin-Dependent and -Independent Manners.
23041287 2012 Molecular machinery for insertion of tail-anchored membrane proteins into the endoplasmic reticulum membrane in mammalian cells.
21444755 2011 WRB is the receptor for TRC40/Asna1-mediated insertion of tail-anchored proteins into the ER membrane.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12189208 2002 Identification of a transcriptionally active peroxisome proliferator-activated receptor alpha -interacting cofactor complex in rat liver and characterization of PRIC285 as a coactivator.
10830953 2000 The DNA sequence of human chromosome 21.
9544840 1998 Identification and characterization of a new human cDNA from chromosome 21q22.3 encoding a basic nuclear protein.
9480850 1998 High resolution physical mapping and identification of transcribed sequences in the Down syndrome region-2.