Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.44
PubTator Score 2.77

Knowledge Summary


No data available


  Disease (1)


  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.232 5.9e-05
group 3 medulloblastoma 1.300 1.1e-03
non primary Sjogren syndrome sicca 1.100 1.4e-02
ovarian cancer 1.200 6.0e-06

Gene RIF (2)

26675238 Cep135 is required for the recruitment of WDR8 to centrioles.
26545777 Knockdown of Wdr8 or hMsd1/SSX2IP displayed very similar mitotic defects, in which spindle microtubules became shortened and misoriented.

AA Sequence

LCWHLSGDSMALLSKDHFCLCFLETEAVVGTACRQLGGHT                                  421 - 460

Text Mined References (14)

PMID Year Title
26675238 2016 WDR8 is a centriolar satellite and centriole-associated protein that promotes ciliary vesicle docking during ciliogenesis.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26545777 2015 The conserved Wdr8-hMsd1/SSX2IP complex localises to the centrosome and ensures proper spindle length and orientation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11401440 2001 Isolation, characterization, and mapping of the mouse and human WDR8 genes, members of a novel WD-repeat gene family.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.