Property Summary

NCBI Gene PubMed Count 23
PubMed Score 24.18
PubTator Score 15.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
interstitial cystitis 2299 1.1e-03
chronic rhinosinusitis 512 2.0e-02
Disease Target Count Z-score Confidence
Motor neuron disease 39 0.0 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.100 1.1e-03
chronic rhinosinusitis -1.065 2.0e-02

 GO Function (1)

Gene RIF (13)

PMID Text
27117272 Inhibition of WNT signaling by the PORCN inhibitor WNT974 reduced metastatic spread of UM-SCC cells, especially in UM-SCCs with Notch1 deficiency.
26174360 expression is enhanced in idiopathic carpal tunnel syndrome
25511584 Silencing Wnt9A increased the expression of CHST11 in the colonic epithelial cells, and chromatin immunoprecipitation assay demonstrated enhancing effects of Wnt9A siRNA and exogenous BMP4 on the CHST11 promoter
24778176 These studies reveal how carrageenan exposure can lead to transcriptional events in colonic epithelial cells through decline in arylsulfatase B activity, with subsequent impact on C4S, galectin-3, Sp1, and Wnt9A
23154410 Transgenic wnt9a is required for palatal extension wherein the chondrocytes form a proliferative front, undergo morphological change and intercalate to form the ethmoid plate.
20854080 Using DirectDNA sequencing analysis, we detected ATBF1, CYLD, PARK2 and WNT9A mutations in stomach and colorectal cancers
20613673 Observational study of gene-disease association. (HuGE Navigator)
19863181 Results demonstrated significant up-regulation of WNT-3, WNT-4, WNT-5B, WNT-7B, WNT-9A, WNT-10A, and WNT-16B in patients with CLL compared to normal subjects.
19453261 Observational study of gene-disease association. (HuGE Navigator)
17429723 cDNA gene expression array of Wnt signaling pathway target genes demonstrated significant changes, including 4.5-fold induction of Wnt 9A and suppression of Dickkopf 3 and RHOU genes.
17351820 These results suggests the expression level of human Wnt9a in MCF-7 that breast cancer may play a role in adjusting the rate of cellular proliferation.
15809769 5'-flanking promoter region was significantly divergent between human WNT9A and rodent Wnt9a genes.
11836627 Found clustered with WNT3A on 1q42. .

AA Sequence

MLDGSPLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACDRLKLERKQRR      1 - 70
MCRRDPGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKA     71 - 140
CSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLVGVKVIKAG    141 - 210
VETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGAGGS    211 - 280
DPLPRTPELVHLDDSPSFCLAGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVE    281 - 350
CRQCTQREEVYTCKG                                                           351 - 365
//

Text Mined References (23)

PMID Year Title
27117272 2016 In vivo Wnt pathway inhibition of human squamous cell carcinoma growth and metastasis in the chick chorioallantoic model.
26174360 2015 Enhanced expression of Wnt9a in the flexor tenosynovium in idiopathic carpal tunnel syndrome.
25511584 2015 Regulation of chondroitin-4-sulfotransferase (CHST11) expression by opposing effects of arylsulfatase B on BMP4 and Wnt9A.
24778176 2014 Increased expression of colonic Wnt9A through Sp1-mediated transcriptional effects involving arylsulfatase B, chondroitin 4-sulfate, and galectin-3.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23154410 2013 Distinct requirements for wnt9a and irf6 in extension and integration mechanisms during zebrafish palate morphogenesis.
20854080 2010 Frameshift mutations of ATBF1, WNT9A, CYLD and PARK2 in gastric and colorectal carcinomas with high microsatellite instability.
20613673 Association between polymorphisms in Wnt signaling pathway genes and bone mineral density in postmenopausal Korean women.
19863181 2009 Variation in WNT genes expression in different subtypes of chronic lymphocytic leukemia.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
17429723 2007 Carrageenan reduces bone morphogenetic protein-4 (BMP4) and activates the Wnt/beta-catenin pathway in normal human colonocytes.
17351820 2008 Knocking down Wnt9a mRNA levels increases cellular proliferation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16258938 2006 Expression patterns of Wnt genes during development of an anterior part of the chicken eye.
15809769 2005 Comparative genomics on Wnt9a orthologs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12573259 2003 Mouse Wnt9b transforming activity, tissue-specific expression, and evolution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11836627 2002 Molecular cloning and expression of mouse Wnt14, and structural comparison between mouse Wnt14-Wnt3a gene cluster and human WNT14-WNT3A gene cluster.
11414706 2001 Molecular cloning and characterization of WNT3A and WNT14 clustered in human chromosome 1q42 region.
11239392 2001 Wnt-14 plays a pivotal role in inducing synovial joint formation in the developing appendicular skeleton.
9441749 1997 Isolation of two novel WNT genes, WNT14 and WNT15, one of which (WNT15) is closely linked to WNT3 on human chromosome 17q21.
8167409 1993 Wnt family proteins are secreted and associated with the cell surface.