Property Summary

NCBI Gene PubMed Count 8
PubMed Score 21.12
PubTator Score 8.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.500 5.4e-03
Astrocytoma, Pilocytic -2.700 7.2e-09
atypical teratoid / rhabdoid tumor -2.000 3.0e-04
Breast cancer -2.100 1.3e-17
ependymoma -3.000 1.1e-03
gastric carcinoma -1.600 5.1e-03
glioblastoma -1.200 1.3e-02
intraductal papillary-mucinous adenoma (... 1.300 1.6e-02
medulloblastoma -1.700 9.0e-04
medulloblastoma, large-cell -2.300 2.7e-04
oligodendroglioma -2.400 5.3e-03
ovarian cancer 1.600 2.8e-11
pediatric high grade glioma -1.800 1.2e-04
primitive neuroectodermal tumor -1.400 4.1e-02

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MPVPPPPPPPLPPPPPPLGAPPPPPPSAPPVSTDTSSLRRADPKGRSALLADIQQGTRLRKVTQINDRSA      1 - 70
PQIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTI     71 - 140
SGPLIPPASPRLGNTSEAHGAARTAPPRPNVPAPPPPTPPPPPPPLPPPLPSSSPIKTPLVSPPGPLTKG    141 - 210
NLPVVAPPVPCAPPPPPPPPPPTPPPLPPASVLSDKAVKPQLAPLHLPPIPPPLPLLPPCGYPGLKAEPA    211 - 280
SPAQDAQEPPAPPPPLPPYASCSPRASLPAPPLPGVNSSSETPPPLPPKSPSFQAPPQKAGAQALPAPPA    281 - 350
PPGSQPFLQKKRHGRPGAGGGKLNPPPAPPARSPTTELSSKSQQATAWTPTQQPGGQLRNGSLHIIDDFE    351 - 420
SKFTFHSVEDFPPPDEYKPCQKIYPSKIPRSRTPGPWLQAEAVGQSSDDIKGRNSQLSLKTLR           421 - 483
//

Text Mined References (10)

PMID Year Title