Property Summary

NCBI Gene PubMed Count 47
PubMed Score 100.91
PubTator Score 61.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
hepatocellular carcinoma -1.300 7.0e-05
Waldenstrons macroglobulinemia 1.644 7.8e-03
malignant mesothelioma -3.100 4.9e-08
cutaneous lupus erythematosus 2.800 7.7e-05
osteosarcoma -1.254 1.3e-02
glioblastoma 1.600 5.3e-04
medulloblastoma, large-cell -1.600 2.8e-02
Duchenne muscular dystrophy 1.171 8.5e-09
juvenile dermatomyositis 1.144 3.7e-09
tuberculosis and treatment for 6 months -1.500 3.3e-04
intraductal papillary-mucinous neoplasm ... -2.100 4.1e-02
sarcoidosis 1.600 1.4e-02
interstitial cystitis 1.700 4.2e-03
cystic fibrosis -1.200 1.1e-04
pediatric high grade glioma 1.600 3.5e-05
pilocytic astrocytoma 2.200 1.6e-08
primary Sjogren syndrome 2.600 1.0e-05
lung carcinoma -1.700 1.8e-24
gastric carcinoma 1.600 3.6e-02
ulcerative colitis 2.700 2.8e-05
ovarian cancer -2.100 5.2e-05

Gene RIF (18)

PMID Text
25413351 conclude that tyrosine phosphorylation of WIP is a crucial regulator of WASP stability and function as an actin-nucleation-promoting factor
24962707 Data indicate the WASp-interacting protein (WIP)-Wiskott-Aldrich syndrome protein (WASp) interaction in the regulation of actin-dependent processes.
22837718 WIP was shown to interact with various binding partners, including the signaling proteins Nck, CrkL and cortactin.
22231303 These findings indicate that WIP deficiency should be suspected in patients with features of WAS in whom WAS sequence and mRNA levels are normal.
21810783 These findings reveal WIP as a previously unreported regulator of neuronal maturation and synaptic activity
19817875 The results suggest that some of the mutations in the WH1 domain cause the Wiskott-Aldrich syndrome syndrome in humans by perturbing the WASP-WIP complex formation.
19399471 Groups of colorectal cancer, breast cancer, and glioma patients with low expression of the WIPF1 co-expression module generally had a favorable prognosis.
19155218 formin-binding protein 17 (FBP17) recruits WASP, WASP-interacting protein (WIP), and dynamin-2 to the plasma membrane and that this recruitment is necessary for the formation of podosomes and phagocytic cups.
18258743 WIP is involved in lytic granule transport and is essential for regulation of Natural killer cell cytotoxic function
17949983 In this review, in addition to its WASP-independent functions, the role of WIP is to regulate the activity and stability of WASP and shuttle WASP to areas of actin assembly.
17890224 that WASP and WASP-interacting protein (WIP) form a complex at the phagocytic cup and that the WASP.WIP complex plays a critical role in the phagocytic cup formation.
17711847 the WIP-WASP complex plays an important role in WASP stabilization and NFAT activation
17213309 WASP-interacting protein stabilizes Wiskott-Aldrich syndrome protein(WASP) and suggest that it may also be important for its function
16606694 A 1.3 mD multiprotein complex consisting of WASp-interacting protein (WIP), Wiskott-Aldrich syndrome protein (WASp), actin, and myosin IIA formigg during NK cell activation was identified with a role in complex formation and NK cell activity regulation.
16488394 Only in the presence of WASP-interacting protein (WIP) can human WASP suppress the growth defect of Saccharomyces cerevisiae las17Delta strain.
15469902 interactions of WASP and WIP are affected by two novel mutations that change the conformation of WASP and disrupt hydrogen bonding
12591280 X-linked thrombocytopenia caused by a mutation in the WAS gene that disrupts interaction with the (WASP)-interacting protein (WIP).
12437929 show that the N-WASP EVH1 domain specifically binds a 25 residue motif from the WASP Interacting Protein (WIP)

AA Sequence

MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILDKPKGAGAGGG      1 - 70
GGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDNDSGGSRPPLLPPGGRSTSAKP     71 - 140
FSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSPHNRGSPPVPGGP    141 - 210
RQPSPGPTPPPFPGNRGTALGGGSIRQSPLSSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHRE    211 - 280
AVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPS    281 - 350
PGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPP    351 - 420
DRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNR    421 - 490
RERGAPPLPPIPR                                                             491 - 503
//

Text Mined References (59)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25413351 2015 Tyrosine phosphorylation of WIP releases bound WASP and impairs podosome assembly in macrophages.
24962707 2014 Triple-color FRET analysis reveals conformational changes in the WIP-WASp actin-regulating complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22837718 2012 WIP remodeling actin behind the scenes: how WIP reshapes immune and other functions.
22231303 2012 A novel primary human immunodeficiency due to deficiency in the WASP-interacting protein WIP.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21810783 2012 WIP is a negative regulator of neuronal maturation and synaptic activity.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21398607 2011 Hematopoietic lineage cell-specific protein 1 functions in concert with the Wiskott-Aldrich syndrome protein to promote podosome array organization and chemotaxis in dendritic cells.
21269460 2011 Initial characterization of the human central proteome.
20936779 2010 A human MAP kinase interactome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19910490 2010 Actin-binding protein-1 interacts with WASp-interacting protein to regulate growth factor-induced dorsal ruffle formation.
19817875 2009 Characterization of Wiskott-Aldrich syndrome (WAS) mutants using Saccharomyces cerevisiae.
19798448 2009 Requirements for F-BAR proteins TOCA-1 and TOCA-2 in actin dynamics and membrane trafficking during Caenorhabditis elegans oocyte growth and embryonic epidermal morphogenesis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19399471 2009 An expression module of WIPF1-coexpressed genes identifies patients with favorable prognosis in three tumor types.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19155218 2009 FBP17 Mediates a Common Molecular Step in the Formation of Podosomes and Phagocytic Cups in Macrophages.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18258743 2008 WIP is essential for lytic granule polarization and NK cell cytotoxicity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17949983 2007 WASP-interacting protein (WIP): working in polymerisation and much more.
17890224 2007 Wiskott-Aldrich syndrome protein is a key regulator of the phagocytic cup formation in macrophages.
17711847 2007 Structure-function analysis of the WIP role in T cell receptor-stimulated NFAT activation: evidence that WIP-WASP dissociation is not required and that the WIP NH2 terminus is inhibitory.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17213309 2007 WIP is a chaperone for Wiskott-Aldrich syndrome protein (WASP).
16606694 2006 Formation of a WIP-, WASp-, actin-, and myosin IIA-containing multiprotein complex in activated NK cells and its alteration by KIR inhibitory signaling.
16582881 2006 Wiskott-Aldrich syndrome protein is involved in alphaIIb beta3-mediated cell adhesion.
16488394 2006 WASP suppresses the growth defect of Saccharomyces cerevisiae las17Delta strain in the presence of WIP.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16275905 2005 Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469902 2004 Two novel mutations of Wiskott-Aldrich syndrome: the molecular prediction of interaction between the mutated WASP L101P with WASP-interacting protein by molecular modeling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12620186 2003 Cortactin interacts with WIP in regulating Arp2/3 activation and membrane protrusion.
12591280 2003 X-linked thrombocytopenia caused by a mutation in the Wiskott-Aldrich syndrome (WAS) gene that disrupts interaction with the WAS protein (WASP)-interacting protein (WIP).
12504004 2002 Mechanism of recruitment of WASP to the immunological synapse and of its activation following TCR ligation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437929 2002 Structure of the N-WASP EVH1 domain-WIP complex: insight into the molecular basis of Wiskott-Aldrich Syndrome.
12372256 2002 The WH1 and EVH1 domains of WASP and Ena/VASP family members bind distinct sequence motifs.
12147689 2002 Phosphatidylinositol 4,5-biphosphate (PIP2)-induced vesicle movement depends on N-WASP and involves Nck, WIP, and Grb2.
12029088 2002 Identification of novel SH3 domain ligands for the Src family kinase Hck. Wiskott-Aldrich syndrome protein (WASP), WASP-interacting protein (WIP), and ELMO1.
11869681 2002 WIP deficiency reveals a differential role for WIP and the actin cytoskeleton in T and B cell activation.
11687573 2002 The rat homologue of Wiskott-Aldrich syndrome protein (WASP)-interacting protein (WIP) associates with actin filaments, recruits N-WASP from the nucleus, and mediates mobilization of actin from stress fibers in favor of filopodia formation.
11331876 2001 WIP regulates N-WASP-mediated actin polymerization and filopodium formation.
10878810 2000 A complex of N-WASP and WIP integrates signalling cascades that lead to actin polymerization.
10358064 1999 The human WASP-interacting protein, WIP, activates the cell polarity pathway in yeast.
10202051 1999 Mutations that cause the Wiskott-Aldrich syndrome impair the interaction of Wiskott-Aldrich syndrome protein (WASP) with WASP interacting protein.
10087612 1999 Waltzing with WASP.
9694849 1998 The Wiskott-Aldrich syndrome protein-interacting protein (WIP) binds to the adaptor protein Nck.
9405671 1997 WIP, a protein associated with wiskott-aldrich syndrome protein, induces actin polymerization and redistribution in lymphoid cells.