Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 9.0e-05
Disease Target Count Z-score Confidence
Chronic fatigue syndrome 25 3.815 1.9

Gene RIF (1)

AA Sequence

MKPWILLLVMFISGVVMLLPVLGSFWNKDPFLDMIRETEQCWVQPPYKYCEKRCTKIMTCVRPNHTCCWT      1 - 70
YCGNICLDNEEPLKSMLNP                                                        71 - 89
//

Text Mined References (7)

PMID Year Title