Property Summary

NCBI Gene PubMed Count 15
PubMed Score 17.39
PubTator Score 4.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7766 5.6e-09

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.743 5.6e-09

Gene RIF (6)

AA Sequence

MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEV      1 - 70
LDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRS     71 - 140
RRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSS    141 - 210
LDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVV    211 - 280
QSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG                                       281 - 315
//

Text Mined References (16)

PMID Year Title