Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.50
PubTator Score 4.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 4.0e-03

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 4.0e-03

 GO Function (1)

Gene RIF (5)

AA Sequence

MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIR      1 - 70
YTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPN     71 - 140
CQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLIL    141 - 210
ISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGK    211 - 280
HTGPITCLQFNPKFMTFASACSNMAFWLPTIDD                                         281 - 313
//

Text Mined References (15)

PMID Year Title