Property Summary

NCBI Gene PubMed Count 66
PubMed Score 100.16
PubTator Score 67.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.500 4.8e-05
group 3 medulloblastoma 1.300 1.2e-02
atypical teratoid / rhabdoid tumor 1.300 7.8e-07
medulloblastoma, large-cell 1.600 3.6e-05
non-small cell lung cancer 1.184 4.3e-15
pediatric high grade glioma 1.500 1.1e-05
ovarian cancer 1.100 6.5e-06

Synonym

Accession P61964 Q91VA5 Q9NWX7 Q9UGP9
Symbols SWD3
BIG-3
CFAP89

Gene

PDB

4Y7R   3UVM   4ERZ   3UVN   4EWR   3UVO   4ES0   3UVL   4ERY   2CNX   2CO0   2G99   2G9A   2GNQ   2H13   2H14   2H68   2H6K   2H6N   2H6Q   2H9L   2H9M   2H9N   2H9P   2O9K   3EG6   3EMH   3MXX   3N0D   3N0E   3P4F   3PSL   3SMR   3UR4   3UVK   4A7J   4CY1   4CY2   4ERQ   4ESG   4GM3   4GM8   4GM9   4GMB   4IA9   4O45   4QL1   5EAL   5EAM   5EAP   5EAR   5SXM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (36)

PMID Text
26471359 Results identify WDR5 as a key cofactor for N-Myc-regulated transcriptional activation and tumorigenesis and as a novel therapeutic target for MYCN-amplified neuroblastomas.
26383167 Target gene recognition by MYC depends on its interaction with WDR5. This interaction could create an avidity-based chromatin recognition mechanism allowing MYC to select its target genes in response to both genetic and epigenetic determinants. Review.
26355959 WDR5 over-expression is associated with poor breast cancer clinical outcome.
26324722 solution structures of the MLL3 core complex assembled with and without WDR5 by small angle x-ray scattering show similar overall topologies
26167872 Wdr5-MLL interaction in C/EBPA N-terminal leukemia is a promising pharmacological target.
26052702 BIG3 may block the KPNAs (KPNA1, KPNA5, and KPNA6) binding region(s) of PHB2.
25666610 findings prove that the TSP-1/CD47/SIRP-alpha signal axis is important to the evolution of tumor cells in the microenvironment of immunotherapy and identify thrombospondin-1 as a key signal
25656485 we have discovered that WDR5 plays an important role in bladder cancer suggesting that WDR5 is a potential biomarker and a promising target in the treatment of bladder cancer.
24793694 results identify WDR5 as a critical epigenomic integrator of histone phosphorylation and methylation and as a major driver of androgen-dependent prostate cancer cell proliferation
24235145 Data indicate that MLL1 methylates Ash2L in the absence of histone H3, but only when assembled within a complex with WDR5 and RbBP5.
24051437 BIG3(WRD5)-PHB2 interaction is critical for the tamoxifen resistance of breast cancer cells; its targeting reverses the resistance.
22989411 A small molecule antagonist binds to WDR5 in the peptide-binding pocket which inhibits the catalytic activity of mixed-lineage leukemia protein.
22829784 we defined a role for Trithorax proteins WDR5 and MLL2 in activating the differentiation gene program in epidermal progenitor cells
22689669 data are consistent with a model in which WDR5 binds the gamma-globin promoter in a PRMT5-dependent manner.
22665483 WDR5-Win motif interaction is important for the assembly of the MLL1 core complex in vivo.
22523547 findings show that WDR5 is a direct target of SRY; the interaction of WDR5 and SRY activates Sox9 expression; results suggest that, in conjunction with SRY, WDR5 plays an important role in sex determination
21816345 WDR5 as a critical substrate of CUL4B in regulating neuronal gene expression.
21220120 crystal structure of WDR5 in ternary complex with RbBP5 and MLL1
20939513 the change of folding free energy by mutations mainly corresponds to the deletion of hydrogen bonds.
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20085832 Results show that Depletion of CHD8 enhances HOXA2 expression and a loss of the WDR5/Ash2L/RbBP5 subcomplex.
20080758 WDR5 is essential in assembling a virus-induced VISA-associated complex and plays an important role in virus-triggered induction of type I interferons.
20018852 NSL is composed of nine subunits. Two of its subunits, WD repeat domain 5 (WDR5) and host cell factor 1 (HCF1), are shared with members of the MLL/SET family of histone H3 lysine 4 (H3K4) methyltransferase complexes.
19496786 Activation of an estrogen/estrogen receptor signaling by BIG3 through its inhibitory effect on nuclear transport of PHB2/REA in breast cancer is reported.
19454010 Three components (Setd1A, CXXC1, WDR5) of the Set1 histone methyltransferase complex are identified to interact with HIV-1 Tat in Jurkat cell
19453261 Observational study of gene-disease association. (HuGE Navigator)
19131338 The identified components revealed factors involved in histone methylation and cell cycle control and include Ash2L, RbBP5, WDR5, HCF-1, DBC-1, and EMSY.
18840606 analysis of interactions between WDR5, the catalytic subunit, MLL, and the substrate, histone H3, of the MLL complex
18829459 WDR5 recognizes Arg-3765 of MLL1, which is essential for the assembly and enzymatic activity of the MLL1 core complex
18829457 WDR5's recognition of arginine 3765 of MLL1 is essential for the assembly and enzymatic activity of the MLL1 core complex in vitro
16946699 involvement of WDR5 in binding and presenting histone H3K4 for further methylation
16878130 WDR5 mediates interactions of the MLL1 catalytic unit both with the common structural platform and with the histone substrate.
16829960 the crystal structure of WDR5 bound to a histone H3
16829959 the high-resolution X-ray structures of WDR5 in the unliganded form and complexed with histone H3 peptides having unmodified and mono-, di- and trimethylated K4
16340128 Wdr5 has a funcitonal role in endocondral bone formation
15960974 The WDR5 is required for binding of the methyltransferase complex to the K4-dimethylated H3 tail as well as for global H3 K4 trimethylation and HOX gene activation in human cells.

AA Sequence

MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIK      1 - 70
IWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ     71 - 140
SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI    141 - 210
DDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED    211 - 280
NLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC                    281 - 334
//

Text Mined References (74)

PMID Year Title
26471359 2015 WDR5 Supports an N-Myc Transcriptional Complex That Drives a Protumorigenic Gene Expression Signature in Neuroblastoma.
26383167 2015 The MYC-WDR5 Nexus and Cancer.
26355959 2015 WDR5 Expression Is Prognostic of Breast Cancer Outcome.
26324722 2015 Unique Role of the WD-40 Repeat Protein 5 (WDR5) Subunit within the Mixed Lineage Leukemia 3 (MLL3) Histone Methyltransferase Complex.
26167872 2015 Pharmacological targeting of the Wdr5-MLL interaction in C/EBP? N-terminal leukemia.
26052702 2015 BIG3 Inhibits the Estrogen-Dependent Nuclear Translocation of PHB2 via Multiple Karyopherin-Alpha Proteins in Breast Cancer Cells.
25666610 2015 WD repeat-containing protein 5 (WDR5) localizes to the midbody and regulates abscission.
25656485 2015 Upregulated WDR5 promotes proliferation, self-renewal and chemoresistance in bladder cancer via mediating H3K4 trimethylation.
25416956 2014 A proteome-scale map of the human interactome network.
24793694 2014 A role for WDR5 in integrating threonine 11 phosphorylation to lysine 4 methylation on histone H3 during androgen signaling and in prostate cancer.
24788516 2014 Structural analysis of the KANSL1/WDR5/KANSL2 complex reveals that WDR5 is required for efficient assembly and chromatin targeting of the NSL complex.
24235145 2014 Automethylation activities within the mixed lineage leukemia-1 (MLL1) core complex reveal evidence supporting a "two-active site" model for multiple histone H3 lysine 4 methylation.
24051437 2013 Targeting BIG3-PHB2 interaction to overcome tamoxifen resistance in breast cancer cells.
23870121 2013 SET1 and p300 act synergistically, through coupled histone modifications, in transcriptional activation by p53.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23178126 2012 Microcephaly gene links trithorax and REST/NRSF to control neural stem cell proliferation and differentiation.
22989411 2013 Small-molecule inhibition of MLL activity by disruption of its interaction with WDR5.
22829784 2012 GRHL3/GET1 and trithorax group members collaborate to activate the epidermal progenitor differentiation program.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22689669 2012 The role of WDR5 in silencing human fetal globin gene expression.
22665483 2012 Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
22523547 2012 Synergistic effect of SRY and its direct target, WDR5, on Sox9 expression.
21816345 2011 X-linked mental retardation gene CUL4B targets ubiquitylation of H3K4 methyltransferase component WDR5 and regulates neuronal gene expression.
21269460 2011 Initial characterization of the human central proteome.
21220120 2011 Structural and biochemical insights into MLL1 core complex assembly.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20939513 2010 The effect of Asp-His-Ser/Thr-Trp tetrad on the thermostability of WD40-repeat proteins.
20581860 2010 Crosstalk between leukemia-associated proteins MOZ and MLL regulates HOX gene expression in human cord blood CD34+ cells.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
20085832 2010 Regulation of HOXA2 gene expression by the ATP-dependent chromatin remodeling enzyme CHD8.
20080758 2010 WDR5 is essential for assembly of the VISA-associated signaling complex and virus-triggered IRF3 and NF-kappaB activation.
20018852 2010 Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19556245 2009 On the mechanism of multiple lysine methylation by the human mixed lineage leukemia protein-1 (MLL1) core complex.
19496786 2009 Activation of an estrogen/estrogen receptor signaling by BIG3 through its inhibitory effect on nuclear transport of PHB2/REA in breast cancer.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19131338 2009 Identification and characterization of a novel nuclear protein complex involved in nuclear hormone receptor-mediated gene regulation.
19103755 2009 The double-histone-acetyltransferase complex ATAC is essential for mammalian development.
18840606 2008 WDR5 interacts with mixed lineage leukemia (MLL) protein via the histone H3-binding pocket.
18838538 2008 Molecular regulation of H3K4 trimethylation by Wdr82, a component of human Set1/COMPASS.
18838386 2008 Human ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein.
18829459 2008 Structure of WDR5 bound to mixed lineage leukemia protein-1 peptide.
18829457 2008 A conserved arginine-containing motif crucial for the assembly and enzymatic activity of the mixed lineage leukemia protein-1 core complex.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
18378692 2008 CHD8 is an ATP-dependent chromatin remodeling factor that regulates beta-catenin target genes.
17998332 2008 Wdr82 is a C-terminal domain-binding protein that recruits the Setd1A Histone H3-Lys4 methyltransferase complex to transcription start sites of transcribed human genes.
17925232 2007 The BRCT-domain containing protein PTIP links PAX2 to a histone H3, lysine 4 methyltransferase complex.
17500065 2007 PTIP associates with MLL3- and MLL4-containing histone H3 lysine 4 methyltransferase complex.
17355966 2007 Identification and characterization of the human Set1B histone H3-Lys4 methyltransferase complex.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17178841 2007 Knockdown of ALR (MLL2) reveals ALR target genes and leads to alterations in cell adhesion and growth.
17041588 2006 CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation.
17021013 2006 Coactivator as a target gene specificity determinant for histone H3 lysine 4 methyltransferases.
16946699 2006 Structural basis for molecular recognition and presentation of histone H3 by WDR5.
16878130 2006 Regulation of MLL1 H3K4 methyltransferase activity by its core components.
16829960 2006 Molecular recognition of histone H3 by the WD40 protein WDR5.
16829959 2006 Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16600877 2006 Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5.
16340128 Wdr5, a novel WD repeat protein, regulates osteoblast and chondrocyte differentiation in vivo.
16253997 2005 CpG-binding protein (CXXC finger protein 1) is a component of the mammalian Set1 histone H3-Lys4 methyltransferase complex, the analogue of the yeast Set1/COMPASS complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15960975 2005 Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF.
15960974 2005 WDR5 associates with histone H3 methylated at K4 and is essential for H3 K4 methylation and vertebrate development.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15199122 2004 Leukemia proto-oncoprotein MLL forms a SET1-like histone methyltransferase complex with menin to regulate Hox gene expression.
14992727 2004 Menin associates with a trithorax family histone methyltransferase complex and with the hoxc8 locus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657013 2004 BIG-3, a novel WD-40 repeat protein, is expressed in the developing growth plate and accelerates chondrocyte differentiation in vitro.
12670868 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11551928 2001 Cloning and characterization of a novel WD-40 repeat protein that dramatically accelerates osteoblastic differentiation.