Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.300 3.7e-02
Astrocytoma, Pilocytic 1.200 2.8e-02
chronic rhinosinusitis -2.010 4.4e-02
cystic fibrosis and chronic rhinosinusit... -1.165 4.2e-02
ependymoma 2.500 2.2e-02
lung adenocarcinoma -1.800 1.2e-11
lung carcinoma -2.600 5.0e-14
nasopharyngeal carcinoma -1.600 5.9e-03
non-small cell lung carcinoma -1.400 2.0e-12

Gene RIF (1)

AA Sequence

MAWREKSKKRLNMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQF      1 - 70
FVERKQLFSFSKDKVLRLWDIQHQLSIQRIACSFPKSQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEA     71 - 140
SKRVKSHEKAVTCVLYNSILKQVISSDTGSTVSFWMIDTGQKIKQFTGCHGNAEISTMALDANETRLLTG    141 - 210
STDGTVKIWDFNGYCHHTLNVGQDGAVDISQILILKKKILVTGWERAITVFRPQNFNQFFIQPEEWKGGI    211 - 280
QHHDDILCAAFLPPQTLVTGSYDGEIVLWNNSTENAHHVLHPDYQRLLKSKLDTKPQKLLSAGRSQPSHP    281 - 350
MADHSTTGVRNFEIDTEGKNAVMRLCFLKARKNTAVTGGANLVSCGGSGYVRFWDIYKKQLLAEFLAHSG    351 - 420
VGSIIMSTDKMNRYLTTGDLDGWLKIWNIEEYCLNSSKNKITKAPTLIRSFQPHEDRISSLEMCEPGGQL    421 - 490
LIISSSADCSICVTGVCNAPVWIFGQAKHWHIENCLFLPKRDTNLVESEIQKEISLFSKEESCLDPTEHS    491 - 560
LLNKKNKDDSTYNVRPSEDINLDIKYKERSTCMKETQKPYYGEVIKKSFSTFRSLNIGALEELPEVNKPA    561 - 630
FLLDPEKYFRKEPEEERPQILEAPSLFKTLKAVFDEKNLFPKEILHHERKAKQLCQEKSCEVKKNKK       631 - 697
//

Text Mined References (13)

PMID Year Title