Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.84
PubTator Score 1.25

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
adrenocortical carcinoma 1427 6.7e-06
Pick disease 1893 1.5e-04
ovarian cancer 8491 2.5e-04
osteosarcoma 7933 2.2e-02
Disease Target Count Z-score Confidence
Disease of mental health 22 0.0 2.0
Disease Target Count Z-score Confidence
Frontotemporal dementia 47 3.997 2.0
Amyotrophic Lateral Sclerosis 432 3.59 1.8


  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.272 2.2e-02
adrenocortical carcinoma 1.238 6.7e-06
Pick disease -1.100 1.5e-04
ovarian cancer 1.800 2.5e-04


Accession Q9HAD4 B4DT55 Q7Z792 Q8IWG3 Q8IXA9 Q8NDA7 Q9NV62
Symbols MSTP048


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

21502949 The peak of association was found in and around two genes, WDR41 and PDE8B, involved in dopamine signaling and development.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

TCSADHLIILWKNGERESGLRSLRLFQKLEENGDLYLAV                                   421 - 459

Text Mined References (12)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
21502949 2011 Discovery and replication of dopamine-related gene effects on caudate volume in young and elderly populations (N=1198) using genome-wide search.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17897319 2007 Integral and associated lysosomal membrane proteins.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.