Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.80
PubTator Score 2.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.7e-05
glioblastoma 1.200 3.0e-07
juvenile dermatomyositis 1.543 7.6e-12
ovarian cancer -1.500 1.2e-03
primary Sjogren syndrome 1.300 2.0e-03
Rheumatoid arthritis 1.400 2.7e-02

Gene RIF (2)

AA Sequence

MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRVWLKRDSGQYWPSIYHTMASP      1 - 70
CSAMAYHHDSRRIFVGQDNGAVMEFHVSEDFNKMNFIKTYPAHQNRVSAIIFSLATEWVISTGHDKCVSW     71 - 140
MCTRSGNMLGRHFFTSWASCLQYDFDTQYAFVGDYSGQITLLKLEQNTCSVITTLKGHEGSVACLWWDPI    141 - 210
QRLLFSGASDNSIIMWDIGGRKGRTLLLQGHHDKVQSLCYLQLTRQLVSCSSDGGIAVWNMDVSREEAPQ    211 - 280
WLESDSCQKCEQPFFWNIKQMWDTKTLGLRQHHCRKCGQAVCGKCSSKRSSYPVMGFEFQVRVCDSCYDS    281 - 350
IKDEDRTSLATFHEGKHNISHMSMDIARGLMVTCGTDRIVKIWDMTPVVGCSLATGFSPH              351 - 410
//

Text Mined References (14)

PMID Year Title