Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.80
PubTator Score 2.78

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis 1.400 2.7e-02
atypical teratoid / rhabdoid tumor 1.300 1.7e-05
glioblastoma 1.200 3.0e-07
juvenile dermatomyositis 1.543 7.6e-12
primary Sjogren syndrome 1.300 2.0e-03
ovarian cancer 2.100 1.0e-03

Gene RIF (1)

PMID Text
25736436 WDFY1 mediates TLR3/TLR4 signaling by recruiting TRIF.

AA Sequence

MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRVWLKRDSGQYWPSIYHTMASP      1 - 70
CSAMAYHHDSRRIFVGQDNGAVMEFHVSEDFNKMNFIKTYPAHQNRVSAIIFSLATEWVISTGHDKCVSW     71 - 140
MCTRSGNMLGRHFFTSWASCLQYDFDTQYAFVGDYSGQITLLKLEQNTCSVITTLKGHEGSVACLWWDPI    141 - 210
QRLLFSGASDNSIIMWDIGGRKGRTLLLQGHHDKVQSLCYLQLTRQLVSCSSDGGIAVWNMDVSREEAPQ    211 - 280
WLESDSCQKCEQPFFWNIKQMWDTKTLGLRQHHCRKCGQAVCGKCSSKRSSYPVMGFEFQVRVCDSCYDS    281 - 350
IKDEDRTSLATFHEGKHNISHMSMDIARGLMVTCGTDRIVKIWDMTPVVGCSLATGFSPH              351 - 410
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25736436 2015 WDFY1 mediates TLR3/4 signaling by recruiting TRIF.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19296456 2009 Membrane insertion of the FYVE domain is modulated by pH.
17332017 2007 Alternative splicing and bioinformatic analysis of human U12-type introns.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11739631 2001 FENS-1 and DFCP1 are FYVE domain-containing proteins with distinct functions in the endosomal and Golgi compartments.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.