Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

 GO Function (1)

Pathway (1)

AA Sequence

MTPVRMQHSLAGQTYAVPLIQPDLRREEAVQQMADALQYLQKVSGDIFSRISQQVEQSRSQVQAIGEKVS      1 - 70
LAQAKIEKIKGSKKAIKVFSSAKYPAPERLQEYGSIFTGAQDPGLQRRPRHRIQSKHRPLDERALQEKDF     71 - 140
PVCVSTKPEPEDDAEEGLGGLPSNISSVSSLLLFNTTENLGKKYVFLDPLAGAVTKTHVMLGAETEEKLF    141 - 210
DAPLSISKREQLEQQVPENYFYVPDLGQVPEIDVPSYLPDLPGITNDLMYIADLGPGIAPSAPGTIPELP    211 - 280
TFHTEVAEPLKVDLQDGVLTPPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQDDSSSSASPSVQGAP    281 - 350
REVVDPSGGRATLLESIRQAGGIGKAKLRSMKERKLEKKQQKEQEQVRATSQGGHLMSDLFNKLVMRRKG    351 - 420
ISGKGPGAGEGPGGAFARVSDSIPPLPPPQQPQAEEDEDDWES                               421 - 463
//

Text Mined References (11)

PMID Year Title
20498093 2010 WASH and WAVE actin regulators of the Wiskott-Aldrich syndrome protein (WASP) family are controlled by analogous structurally related complexes.
20175130 2010 WASH and the Arp2/3 complex regulate endosome shape and trafficking.
18159949 2007 Human subtelomeric WASH genes encode a new subclass of the WASP family.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11701968 2001 Characterization of the murine orthologue of a novel human subtelomeric multigene family.
10655549 2000 Differentially regulated and evolved genes in the fully sequenced Xq/Yq pseudoautosomal region.