Property Summary

NCBI Gene PubMed Count 48
PubMed Score 974.29
PubTator Score 649.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
chronic lymphocytic leukemia 1.562 1.5e-02
esophageal adenocarcinoma 1.500 1.8e-02
cutaneous lupus erythematosus 1.900 2.9e-03
glioblastoma 1.600 4.9e-02
juvenile dermatomyositis 1.881 7.8e-14
lung cancer -1.600 7.7e-05
active Crohn's disease 2.322 3.7e-03
ulcerative colitis 3.200 8.8e-08
interstitial cystitis 2.300 3.8e-04
sarcoidosis 1.100 1.0e-04
subependymal giant cell astrocytoma 1.946 1.9e-02
MYELODYSPLASTIC SYNDROME -1.100 3.5e-02
psoriasis 1.200 8.1e-08
inflammatory breast cancer 1.100 1.9e-03
ovarian cancer 2.100 3.0e-05
dermatomyositis 1.700 4.2e-03
head and neck cancer and chronic obstruc... 1.400 4.7e-02

Gene RIF (27)

PMID Text
26209610 Overexpression of WARS predicts no recurrence and good survival for triple-negative breast cancer patients.
24515434 Tryptophanyl-tRNA synthetase expression is up-regulated in patients with rheumatoid arthritis.
23670221 Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14)
23651343 Indoleamine2,3-dioxygenase and tryptophanyl-tRNA synthetase may play critical roles in the immune pathogenesis of chronic kidney disease.
21926542 Tryptophanyl-tRNA synthetase down-regulation by hypoxia may be a factor responsible for low TrpRS in pancreatic tumors with high metastatic ability.
21442253 Naturally occurring fragments of the two proteins involved in translation, TyrRS and TrpRS, have opposing activities on angiogenesis.
20963594 Mini-tryptophanyl-tRNA synthetase inhibited ischemic angiogenesis in rats.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19900940 Low tryptophanyl-tRNA synthetase is associated with recurrence in colorectal cancer.
19768679 Tryptophanyl-tRNA synthetase is a multidomain protein exhibiting excellent allosteric communication, and this research has provided valuable structural as well as functional insights into the protein.
19363598 Indoleamine 2,3-dioxygenase (IDO)-expression in antigen-presenting cells (APCs) may control autoimmune responses by depleting the available tryptophan, whereas tryptophanyl-tRNA synthetase (TTS) may counteract this effect
18180246 Analysis of the molecular basis of the mechanisms of the substrate recognition and the activation reaction by tryptophanyl-tRNA synthetase.
17999956 the annexin II-S100A10 complex, which regulates exocytosis, forms a ternary complex with TrpRS.
17877375 Results provide the first evidence of the involvement of heme in regulation of TrpRS aminoacylation activity.
16798914 The first crystal structure of human tryptophanyl-tRNA synthetase (hTrpRS) in complex with tRNA(Trp) and Trp which, together with biochemical data, reveals the molecular basis of a novel tRNA binding and recognition mechanism.
16724112 These crystals captured two conformations of the human tryptophanyl-tRNA synthetase and tRNATrp complex, which are nearly identical with respect to the protein and a bound tryptophan.
16702215 The Capsid domain of HIV-1 Gag is sufficient for the interaction of Gag with tryptophanyl-tRNA synthetase in an in vitro pull-down assay
15939065 Observational study of gene-disease association. (HuGE Navigator)
15628863 May play an important role in the intracellular regulation of protein synthesis under conditions of oxidative stress.
14671330 A crystal structure of human tryptophanyl-tRNA synthetase was solved at 2.1 A with a tryptophanyl-adenylate bound at the active site
14660560 results suggest that mammalian and bacterial tryptophanyl-tRNA synthetase might use different mechanisms to recognize the substrate and modeling studies indicate that transfer RNA binds with the dimeric enzyme
14630953 TrpRS may have a role in the maintenance of vascular homeostasis
12416978 The recently discovered antiangiogenic and cell-signaling activities of tryptophanyl-tRNA synthetase bioactive fragments are discussed in this review.
11834741 Recognition by tryptophanyl-tRNA synthetases of discriminator base on tRNATrp from three biological domains
11773626 Thus, protein synthesis may be linked to the regulation of angiogenesis by a natural fragment of TrpRS
11773625 In this study, we show that a recombinant form of a COOH-terminal fragment of TrpRS is a potent antagonist of vascular endothelial growth factor-induced angiogenesis in a mouse model and of naturally occurring retinal angiogenesis in the neonatal mouse

AA Sequence

MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPT      1 - 70
SNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSH     71 - 140
RDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQ    141 - 210
AYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISF    211 - 280
PAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKM    281 - 350
SASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY    351 - 420
TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ                       421 - 471
//

Text Mined References (60)

PMID Year Title
26209610 2015 Prediction of Recurrence and Survival for Triple-Negative Breast Cancer (TNBC) by a Protein Signature in Tissue Samples.
24515434 2015 Increased TTS expression in patients with rheumatoid arthritis.
23670221 2014 Fat depot-specific mRNA expression of novel loci associated with waist-hip ratio.
23651343 2013 Serum levels and activity of indoleamine2,3-dioxygenase and tryptophanyl-tRNA synthetase and their association with disease severity in patients with chronic kidney disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21926542 2011 Hypoxia signature of splice forms of tryptophanyl-tRNA synthetase marks pancreatic cancer cells with distinct metastatic abilities.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21442253 2012 Inhibition of mini-TyrRS-induced angiogenesis response in endothelial cells by VE-cadherin-dependent mini-TrpRS.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20963594 2011 Effect of mini-tyrosyl-tRNA synthetase/mini-tryptophanyl-tRNA synthetase on ischemic angiogenesis in rats: proliferation and migration of endothelial cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19900940 2009 The prognostic significance of tryptophanyl-tRNA synthetase in colorectal cancer.
19768679 2010 Allostery and conformational free energy changes in human tryptophanyl-tRNA synthetase from essential dynamics and structure networks.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19363598 2009 Increased TTS abrogates IDO-mediated CD4(+) T cells suppression in patients with Graves' disease.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18180246 2008 Catalytic mechanism of the tryptophan activation reaction revealed by crystal structures of human tryptophanyl-tRNA synthetase in different enzymatic states.
17999956 2008 Evidence for annexin II-S100A10 complex and plasmin in mobilization of cytokine activity of human TrpRS.
17877375 2007 Human tryptophanyl-tRNA synthetase binds with heme to enhance its aminoacylation activity.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16798914 2006 Structure of human tryptophanyl-tRNA synthetase in complex with tRNATrp reveals the molecular basis of tRNA recognition and specificity.
16724112 2006 Two conformations of a crystalline human tRNA synthetase-tRNA complex: implications for protein synthesis.
16341674 2005 Transcriptome analysis of human gastric cancer.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15939065 2005 Tryptophanyl-tRNA synthetase gene polymorphisms and risk of incident myocardial infarction.
15628863 2005 Oxidative stress-responsive intracellular regulation specific for the angiostatic form of human tryptophanyl-tRNA synthetase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14671330 2003 Crystal structures that suggest late development of genetic code components for differentiating aromatic side chains.
14660560 2004 Crystal structure of human tryptophanyl-tRNA synthetase catalytic fragment: insights into substrate recognition, tRNA binding, and angiogenesis activity.
14630953 2003 Biologically active fragment of a human tRNA synthetase inhibits fluid shear stress-activated responses of endothelial cells.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12416978 2002 Activation of angiogenic signaling pathways by two human tRNA synthetases.
11829477 2002 Interaction network of human aminoacyl-tRNA synthetases and subunits of elongation factor 1 complex.
11773626 2002 A human aminoacyl-tRNA synthetase as a regulator of angiogenesis.
11773625 2002 A fragment of human TrpRS as a potent antagonist of ocular angiogenesis.
11474204 2001 Assignment of human NADH dehydrogenase (ubiquinone) 1 beta subcomplex 3 (NDUFB3) and of its four pseudogenes to human chromosomes 2q31.3, 1p13.3-->p13.1, 9q32-->q34.1, 14q22.3-->q23.1 and 14q32.2 by radiation hybrid mapping.
9731757 1998 Modulation of cellular tryptophan metabolism in human fibroblasts by transforming growth factor-beta: selective inhibition of indoleamine 2,3-dioxygenase and tryptophanyl-tRNA synthetase gene expression.
8864140 1996 Differential screening identifies genetic markers of monocyte to macrophage maturation.
8724762 [Alternative splicing of 5'-terminal exons of the human tryptophanyl-tRNA synthetase gene].
8646895 1996 Assignment of the human tryptophanyl-tRNA synthetase gene (WARS) to chromosome 14q32.2 --> q32.32.
8496617 1993 Gamma interferon potently induces tryptophanyl-tRNA synthetase expression in human keratinocytes.
7925483 1993 Immunoelectron microscopic location of tryptophanyl-tRNA synthetase in mammalian, prokaryotic and archaebacterial cells.
7814400 1995 Transcriptional regulation of the interferon-gamma-inducible tryptophanyl-tRNA synthetase includes alternative splicing.
7685728 1993 The human gene encoding tryptophanyl-tRNA synthetase: interferon-response elements and exon-intron organization.
1765274 1991 Cloning and nucleotide sequence of the structural gene encoding for human tryptophanyl-tRNA synthetase.
1763065 1991 Human interferon gamma potently induces the synthesis of a 55-kDa protein (gamma 2) highly homologous to rabbit peptide chain release factor and bovine tryptophanyl-tRNA synthetase.
1761529 1991 Interferon induces tryptophanyl-tRNA synthetase expression in human fibroblasts.
1537332 1992 Molecular cloning and characterization of an interferon induced human cDNA with sequence homology to a mammalian peptide chain release factor.
1373391 1992 An interferon-induced protein with release factor activity is a tryptophanyl-tRNA synthetase.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.