Property Summary

NCBI Gene PubMed Count 54
PubMed Score 518.57
PubTator Score 649.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.904 5.1e-03
active ulcerative colitis 1.541 1.9e-02
Breast cancer 1.100 2.5e-03
Chronic Lymphocytic Leukemia 1.562 1.5e-02
cutaneous lupus erythematosus 1.700 1.1e-02
dermatomyositis 1.700 4.2e-03
esophageal adenocarcinoma 1.500 1.8e-02
glioblastoma 1.600 4.9e-02
head and neck cancer and chronic obstruc... 1.400 4.7e-02
interstitial cystitis 2.200 6.7e-04
juvenile dermatomyositis 1.317 1.7e-07
lung cancer -1.300 4.7e-03
MYELODYSPLASTIC SYNDROME -1.100 3.5e-02
ovarian cancer 2.100 3.0e-05
psoriasis 1.200 8.1e-08
sarcoidosis 1.100 1.0e-04
subependymal giant cell astrocytoma 1.946 1.9e-02

PDB (11)

Gene RIF (29)

AA Sequence

MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPT      1 - 70
SNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSH     71 - 140
RDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQ    141 - 210
AYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISF    211 - 280
PAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKM    281 - 350
SASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY    351 - 420
TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ                       421 - 471
//

Text Mined References (64)

PMID Year Title