Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.25
PubTator Score 9.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.700 1.4e-05
psoriasis -1.400 2.4e-04
osteosarcoma -1.767 3.5e-03
posterior fossa group A ependymoma 1.300 9.1e-07
astrocytoma 1.200 2.1e-02
glioblastoma 1.600 4.2e-03
group 3 medulloblastoma 1.700 2.0e-02
medulloblastoma, large-cell -1.200 2.1e-02
non-small cell lung cancer -1.232 9.8e-14
colon cancer -2.100 2.7e-02
lung cancer 2.300 3.2e-05
pilocytic astrocytoma 1.600 4.1e-07
subependymal giant cell astrocytoma 1.658 1.2e-02
nasopharyngeal carcinoma -1.300 4.7e-09
Breast cancer -1.500 6.9e-07

Synonym

Accession O00534 Q6UN19 Q6UN20 Q9BVF8
Symbols BCSC1
BCSC-1
LOH11CR2A

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
22594792 BCSC-1 binds to Sox10, which down regulates MITF, and results in a switch of melanoma cells from a proliferative to a migratory phenotype.
21803008 LOH11CR2A, PIG8 and CHEK1 are candidate tumor suppressor genes associated with breast carcinoma and have significant clinical as well as prognostic importance.
19656157 BCSC-1 suppression might play roles in tumorigenesis of some nasopharyngeal carcinomas

AA Sequence

MVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDG      1 - 70
KKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQELPLEADGA     71 - 140
LRFVLPAVLNPRYQFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGED    141 - 210
KTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPNMKPGHLMGDPSAMVSFYPNIPEDQPSNTCG    211 - 280
EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTM    281 - 350
EEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHRCFSFG    351 - 420
IGEGTSTSLIKGIARASGGTSEFITGKDRMQSKALRTLKRSLQPVVEDVSLSWHLPPGLSAKMLSPEQTV    421 - 490
IFRGQRLISYAQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKPDVNLTIHRLAAKSLLQTKDMG    491 - 560
LRETPASDKKDALNLSLESGVISSFTAFIAINKELNKPVQGPLAHRDVPRPILLGASAPLKIKCQSGFRK    561 - 630
ALHSDRPPSASQPRGELMCYKAKTFQMDDYSLCGLISHKDQHSPGFGENHLVQLIYHQNANGSWDLNEDL    631 - 700
AKILGMSLEEIMAAQPAELVDSSGWATILAVIWLHSNGKDLKCEWELLERKAVAWMRAHAGSTMPSVVKA    701 - 770
AITFLKSSVDPAIFAF                                                          771 - 786
//

Text Mined References (11)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22594792 2012 Breast cancer suppressor candidate-1 (BCSC-1) is a melanoma tumor suppressor that down regulates MITF.
21803008 2011 Frequent alterations of LOH11CR2A, PIG8 and CHEK1 genes at chromosomal 11q24.1-24.2 region in breast carcinoma: clinical and prognostic implications.
21782286 2011 A genome-wide association study of aging.
19656157 2009 Tumor suppressor function of BCSC-1 in nasopharyngeal carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14504409 2003 The BCSC-1 locus at chromosome 11q23-q24 is a candidate tumor suppressor gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9417908 1997 Molecular cloning and characterization of LOH11CR2A, a new gene within a refined minimal region of LOH at 11q23.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.