Property Summary

NCBI Gene PubMed Count 25
PubMed Score 30.34
PubTator Score 17.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (8)

PMID Text
25655281 TLP expression contributes to hypertrophic scar formation and contraction.
23418473 TLP likely acts as a molecular modulator capable of altering the balance of Smad3- and Smad2-dependent signaling through regulation of phosphorylation, thus facilitating collagen synthesis in fibroblasts.
23167963 Vps39 knockdown impairs late endosome fusion and fusion between late endosomes and lysosomes.
21454559 Merkel cell polyomavirus large T antigen disrupts lysosome clustering by translocating human Vam6p from the cytoplasm to the nucleus
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20363736 although only TBC1D15/Rab7-GAP altered Rab7-GTP levels, both Rab7-GAP and mVps39 regulate lysosomal morphology and play a role in maintaining growth factor dependence
19913121 Observational study of gene-disease association. (HuGE Navigator)
12941698 propose that TLP might regulate the balance of Smad2 and Smad3 signaling by localizing Smad4 intracellularly, thus contributing to cellular specificity of TGF-beta transcriptional responses in both normal and pathophysiology

AA Sequence

MHDAFEPVPILEKLPLQIDCLAAWEEWLLVGTKQGHLLLYRIRKDVVPADVASPESGSCNRFEVTLEKSN      1 - 70
KNFSKKIQQIHVVSQFKILVSLLENNIYVHDLLTFQQITTVSKAKGASLFTCDLQHTETGEEVLRMCVAV     71 - 140
KKKLQLYFWKDREFHELQGDFSVPDVPKSMAWCENSICVGFKRDYYLIRVDGKGSIKELFPTGKQLEPLV    141 - 210
APLADGKVAVGQDDLTVVLNEEGICTQKCALNWTDIPVAMEHQPPYIIAVLPRYVEIRTFEPRLLVQSIE    211 - 280
LQRPRFITSGGSNIIYVASNHFVWRLIPVPMATQIQQLLQDKQFELALQLAEMKDDSDSEKQQQIHHIKN    281 - 350
LYAFNLFCQKRFDESMQVFAKLGTDPTHVMGLYPDLLPTDYRKQLQYPNPLPVLSGAELEKAHLALIDYL    351 - 420
TQKRSQLVKKLNDSDHQSSTSPLMEGTPTIKSKKKLLQIIDTTLLKCYLHTNVALVAPLLRLENNHCHIE    421 - 490
ESEHVLKKAHKYSELIILYEKKGLHEKALQVLVDQSKKANSPLKGHERTVQYLQHLGTENLHLIFSYSVW    491 - 560
VLRDFPEDGLKIFTEDLPEVESLPRDRVLGFLIENFKGLAIPYLEHIIHVWEETGSRFHNCLIQLYCEKV    561 - 630
QGLMKEYLLSFPAGKTPVPAGEEEGELGEYRQKLLMFLEISSYYDPGRLICDFPFDGLLEERALLLGRMG    631 - 700
KHEQALFIYVHILKDTRMAEEYCHKHYDRNKDGNKDVYLSLLRMYLSPPSIHCLGPIKLELLEPKANLQA    701 - 770
ALQVLELHHSKLDTTKALNLLPANTQINDIRIFLEKVLEENAQKKRFNQVLKNLLHAEFLRVQEERILHQ    771 - 840
QVKCIITEEKVCMVCKKKIGNSAFARYPNGVVVHYFCSKEVNPADT                            841 - 886
//

Text Mined References (29)

PMID Year Title
26463206 2015 Characterization of the Mammalian CORVET and HOPS Complexes and Their Modular Restructuring for Endosome Specificity.
25908847 2015 The small GTPase Arl8b regulates assembly of the mammalian HOPS complex on lysosomes.
25783203 2015 Recruitment of VPS33A to HOPS by VPS16 Is Required for Lysosome Fusion with Endosomes and Autophagosomes.
25655281 2015 Functional characterization of TRAP1-like protein involved in modulating fibrotic processes mediated by TGF-?/Smad signaling in hypertrophic scar fibroblasts.
25266290 2014 Mammalian CORVET is required for fusion and conversion of distinct early endosome subpopulations.
24554770 2014 The HOPS complex mediates autophagosome-lysosome fusion through interaction with syntaxin 17.
23901104 2013 Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
23418473 2013 Effects of TRAP-1-like protein (TLP) gene on collagen synthesis induced by TGF-?/Smad signaling in human dermal fibroblasts.
23351085 2013 Tethering complexes in the endocytic pathway: CORVET and HOPS.
23167963 2013 The HOPS proteins hVps41 and hVps39 are required for homotypic and heterotypic late endosome fusion.
21454559 2011 Merkel cell polyomavirus large T antigen disrupts lysosome clustering by translocating human Vam6p from the cytoplasm to the nucleus.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20363736 2010 Differential effects of TBC1D15 and mammalian Vps39 on Rab7 activation state, lysosomal morphology, and growth factor dependence.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19109425 2009 SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17897319 2007 Integral and associated lysosomal membrane proteins.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12941698 2003 TLP, a novel modulator of TGF-beta signaling, has opposite effects on Smad2- and Smad3-dependent signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11448994 2001 Human Vam6p promotes lysosome clustering and fusion in vivo.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.