Property Summary

NCBI Gene PubMed Count 20
PubMed Score 8.10
PubTator Score 7.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
juvenile dermatomyositis 1.038 5.0e-07
tuberculosis and treatment for 3 months -1.500 8.4e-05
progressive supranuclear palsy -1.100 1.2e-02
ovarian cancer -1.500 1.4e-03

 GWAS Trait (2)

Protein-protein Interaction (5)

Gene RIF (6)

PMID Text
22891969 Low HCRP1 expression was found to be of adverse prognostic significance in patients with oral and oropharyngeal squamous cell carcinoma who received preoperative chemoradiotherapy
22717650 The missense mutation c.1146A>T in Vps37A causes autosomal recessive complex hereditary spastic paraparesis.
22016507 Data show hVps37A mRNA downregulation in ovarian cancer.
18005716 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
15240819 HCRP1 is a subunit of mammalian ESCRT-I, and its function is essential for lysosomal sorting of EGF receptors.
14623289 Our results strongly suggest that HCRP1 might be a growth inhibitory protein and associated with decreasing the invasion of HCC cells

AA Sequence

MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTINNLTININILLP      1 - 70
PQFPQEKPVISVYPPIRHHLMDKQGVYVTSPLVNNFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTAFPYL     71 - 140
YSNPSGMSPYASQGFPFLPPYPPQEANRSITSLSVADTVSSSTTSHTTAKPAAPSFGVLSNLPLPIPTVD    141 - 210
ASIPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELA    211 - 280
RKNLLLEPSLEAKRQTVLDKYELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAE    281 - 350
DFLEGKMEIDDFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL                           351 - 397
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22891969 2013 HCRP1 expression status is a significant prognostic marker in oral and oropharyngeal cancer.
22717650 2012 A founder mutation in Vps37A causes autosomal recessive complex hereditary spastic paraparesis.
22016507 2011 hVps37A Status affects prognosis and cetuximab sensitivity in ovarian cancer.
21757351 2011 UBAP1 is a component of an endosome-specific ESCRT-I complex that is essential for MVB sorting.
21269460 2011 Initial characterization of the human central proteome.
20654576 2010 Distinct functions of human MVB12A and MVB12B in the ESCRT-I dependent on their posttranslational modifications.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18005716 2007 Identification of human MVB12 proteins as ESCRT-I subunits that function in HIV budding.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903302 2007 Framingham Heart Study 100K Project: genome-wide associations for blood pressure and arterial stiffness.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15509564 2005 Identification of human VPS37C, a component of endosomal sorting complex required for transport-I important for viral budding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15240819 2004 The growth-regulatory protein HCRP1/hVps37A is a subunit of mammalian ESCRT-I and mediates receptor down-regulation.
15218037 2004 The human endosomal sorting complex required for transport (ESCRT-I) and its role in HIV-1 budding.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623289 2003 HCRP1, a novel gene that is downregulated in hepatocellular carcinoma, encodes a growth-inhibitory protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
9875212 1998 Polar amino acid-rich sequences bind to polyglutamine tracts.