Property Summary

NCBI Gene PubMed Count 64
PubMed Score 30.39
PubTator Score 29.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.829 5.8e-03
Multiple myeloma 1.625 6.6e-04
lung adenocarcinoma -1.100 2.3e-06
ovarian cancer -1.700 3.2e-05
dermatomyositis 1.300 4.0e-04

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (12)

PMID Text
25475142 This study demonstrated that Genetic variability of VPS26A in parkinsonism.
25393110 Mutagenesis studies coupled with coimmunoprecipitations revealed that retromer-mediated trafficking requires the Env cytoplasmic tail that we show binds directly to retromer components Vps35 and Vps26.
25393110 The gp41 cytoplasmic tail binds directly to retromer components VPS26 and VPS35 in HIV-1-infected cells
25367362 provides molecular insights into the essential role of Vps26 and Vps35 in Rab7-mediated recruitment of the core retromer complex
25136126 VPS26A binding increases the affinity of the SNX27 PDZ domain for PDZ- binding motifs by an order of magnitude, revealing cooperativity in cargo selection.
24684791 Mutations in the gene composing the retromer cargo recognition subunit are not a common cause of Parkinson's disease.
24417787 Mutations in VPS26A are not a frequent cause of Parkinson's disease.
22284051 Rabankyrin-5 interacts with EHD1 and Vps26 to regulate endocytic trafficking and retromer function
21920005 Colocalization of Vps26 paralogues with different endosomally located Rab proteins shows prolonged association of Vps26B-retromer with maturing endosomes relative to Vps26A-retromer.
19531583 Membrane recruitment of the cargo-selective retromer subcomplex VPS35/29/26 is catalysed by the small GTPase Rab7 and inhibited by the Rab-GAP TBC1D5.
17101778 These observations indicate that the mammalian retromer complex assembles by sequential association of SNX1/2 and Vps26-Vps29-Vps35 subcomplexes on endosomal membranes and that SNX1 and SNX2 play interchangeable but essential roles.
16784798 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRI      1 - 70
EFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRL     71 - 140
TDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQ    141 - 210
LIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVD    211 - 280
EEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM                           281 - 327
//

Text Mined References (72)

PMID Year Title
27385586 2016 Parkinson Disease-linked Vps35 R524W Mutation Impairs the Endosomal Association of Retromer and Induces ?-Synuclein Aggregation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26395551 2016 Effect of six type II diabetes susceptibility loci and an FTO variant on obesity in Pakistani subjects.
26220253 2015 Retromer: Structure, function, and roles in mammalian disease.
26199408 2015 The retromer complex in development and disease.
26172538 2015 Retromer Ensures the Degradation of Autophagic Cargo by Maintaining Lysosome Function in Drosophila.
25937119 2015 VPS29-VPS35 intermediate of retromer is stable and may be involved in the retromer complex assembly process.
25475142 2015 Genetic variability of the retromer cargo recognition complex in parkinsonism.
25412306 2014 Characterization of novel markers of senescence and their prognostic potential in cancer.
25393110 2014 Retromer regulates HIV-1 envelope glycoprotein trafficking and incorporation into virions.
25367362 2015 Molecular insights into Rab7-mediated endosomal recruitment of core retromer: deciphering the role of Vps26 and Vps35.
25136126 2014 A unique PDZ domain and arrestin-like fold interaction reveals mechanistic details of endocytic recycling by SNX27-retromer.
24915984 2014 Vacuolar protein sorting 35 (Vps35) rescues locomotor deficits and shortened lifespan in Drosophila expressing a Parkinson's disease mutant of Leucine-Rich Repeat Kinase 2 (LRRK2).
24684791 2014 Genetic variation of the retromer subunits VPS26A/B-VPS29 in Parkinson's disease.
24643499 2014 RME-8 coordinates the activity of the WASH complex with the function of the retromer SNX dimer to control endosomal tubulation.
24417787 2014 Mutations in VPS26A are not a frequent cause of Parkinson's disease.
24359953 2014 Image-based and biochemical assays to investigate endosomal protein sorting.
24344282 2014 A mechanism for retromer endosomal coat complex assembly with cargo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23903356 2013 Identification of HKDC1 and BACE2 as genes influencing glycemic traits during pregnancy through genome-wide association studies.
23563491 2013 A global analysis of SNX27-retromer assembly and cargo specificity reveals a function in glucose and metal ion transport.
23439653 2013 Constitutive internalization of the leucine-rich G protein-coupled receptor-5 (LGR5) to the trans-Golgi network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23372846 2013 The miRNA profile of human pancreatic islets and beta-cells and relationship to type 2 diabetes pathogenesis.
23043714 2012 Genome-wide association studies-derived susceptibility loci in type 2 diabetes: confirmation in a Chinese population.
23029454 2012 A single nucleotide polymorphism within DUSP9 is associated with susceptibility to type 2 diabetes in a Japanese population.
22673115 2012 Identification of Alzheimer disease-associated variants in genes that regulate retromer function.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22431521 2012 The role of ceroid lipofuscinosis neuronal protein 5 (CLN5) in endosomal sorting.
22284051 2012 Rabankyrin-5 interacts with EHD1 and Vps26 to regulate endocytic trafficking and retromer function.
22279231 2012 Retromer binds the FANSHY sorting motif in SorLA to regulate amyloid precursor protein sorting and processing.
22070227 2012 Recruitment of the endosomal WASH complex is mediated by the extended 'tail' of Fam21 binding to the retromer protein Vps35.
21920005 2011 Vps26A and Vps26B subunits define distinct retromer complexes.
21874001 2011 Genome-wide association study in individuals of South Asian ancestry identifies six new type 2 diabetes susceptibility loci.
21725319 2011 A SNX3-dependent retromer pathway mediates retrograde transport of the Wnt sorting receptor Wntless and is required for Wnt secretion.
21602791 2011 SNX27 mediates retromer tubule entry and endosome-to-plasma membrane trafficking of signalling receptors.
21269460 2011 Initial characterization of the human central proteome.
20923837 2010 The cargo-selective retromer complex is a recruiting hub for protein complexes that regulate endosomal tubule dynamics.
20875039 2011 Assembly and solution structure of the core retromer protein complex.
20682791 2010 A protein interaction network for Ecm29 links the 26 S proteasome to molecular motors and endosomal components.
20619655 2010 Vps35 mediates vesicle transport between the mitochondria and peroxisomes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19935774 2009 The retromer component SNX6 interacts with dynactin p150(Glued) and mediates endosome-to-TGN transport.
19619496 2009 The retromer coat complex coordinates endosomal sorting and dynein-mediated transport, with carrier recognition by the trans-Golgi network.
19531583 2009 Membrane recruitment of the cargo-selective retromer subcomplex is catalysed by the small GTPase Rab7 and inhibited by the Rab-GAP TBC1D5.
18193037 2008 Wingless secretion requires endosome-to-Golgi retrieval of Wntless/Evi/Sprinter by the retromer complex.
17868075 2007 EHD1 interacts with retromer to stabilize SNX1 tubules and facilitate endosome-to-Golgi retrieval.
17696874 2007 Identification of a conserved motif required for Vps35p/Vps26p interaction and assembly of the retromer complex.
17550970 2007 The retromer component sorting nexin-1 is required for efficient retrograde transport of Shiga toxin from early endosome to the trans Golgi network.
17148574 2007 A loss-of-function screen reveals SNX5 and SNX6 as potential components of the mammalian retromer.
17101778 2007 Interchangeable but essential functions of SNX1 and SNX2 in the association of retromer with endosomes and the trafficking of mannose 6-phosphate receptors.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16784798 2007 No association of vacuolar protein sorting 26 polymorphisms with Alzheimer's disease.
16737443 2006 The human Vps29 retromer component is a metallo-phosphoesterase for a cation-independent mannose 6-phosphate receptor substrate peptide.
16732284 2006 The retromer subunit Vps26 has an arrestin fold and binds Vps35 through its C-terminal domain.
16407403 2006 An essential role for SNX1 in lysosomal sorting of protease-activated receptor-1: evidence for retromer-, Hrs-, and Tsg101-independent functions of sorting nexins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16315276 2005 Model-guided microarray implicates the retromer complex in Alzheimer's disease.
16190980 2005 A novel mammalian retromer component, Vps26B.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15282546 2004 Exportin 7 defines a novel general nuclear export pathway.
15247922 2004 The mammalian retromer regulates transcytosis of the polymeric immunoglobulin receptor.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15078903 2004 Role of the mammalian retromer in sorting of the cation-independent mannose 6-phosphate receptor.
15078902 2004 Cargo-selective endosomal sorting for retrieval to the Golgi requires retromer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11598206 2001 Vps26p, a component of retromer, directs the interactions of Vps35p in endosome-to-Golgi retrieval.
11102511 2000 Human orthologs of yeast vacuolar protein sorting proteins Vps26, 29, and 35: assembly into multimeric complexes.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
9653160 1998 Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning.
1638986 1992 Identification and characterization of a novel, evolutionarily conserved gene disrupted by the murine H beta 58 embryonic lethal transgene insertion.