Property Summary

NCBI Gene PubMed Count 26
PubMed Score 17.65
PubTator Score 8.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.200 2.4e-03
pancreatic ductal adenocarcinoma liver m... -1.142 5.8e-03

Protein-protein Interaction (5)

Gene RIF (8)

AA Sequence

MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLP      1 - 70
VESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEE     71 - 140
FHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF                                      141 - 176
//

Text Mined References (31)

PMID Year Title