Property Summary

NCBI Gene PubMed Count 26
PubMed Score 16.11
PubTator Score 8.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.142 5.8e-03
diabetes mellitus -1.200 2.4e-03

Gene RIF (8)

PMID Text
26268989 HIV-1 release (as measured by CA-p24 levels) from cells involves VPS25 (EAP20)
26268989 shRNA knockdown of VPS25 (ESCRT-II component) impairs HIV-1 CA-p24 production when using wild type (HIV-1 LAI) and VSV-pseudotyped virus; HIV replication is enhanced by VPS25
23305486 HIV-1 release (as measured by CA-p24 levels) from cells involves VPS25 (EAP20)
21543492 HIV-1 release (as measured by CA-p24 levels) from cells involves VPS25 (EAP20)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19686684 Results describe the mapping of multivesicular bodies with the second winged helix domain of human ESCRT-II subunit VPS25 and the first helix of ESCRT-III subunit VPS20.
16371348 mammalian ESCRTII is made up of hVps25p, hVps22p, and hVps36p and may be redundant, cargo-specific, or not required for protein sorting at the multivesicular body

AA Sequence

MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLP      1 - 70
VESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEE     71 - 140
FHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF                                      141 - 176
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19686684 2009 Structure and function of the ESCRT-II-III interface in multivesicular body biogenesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18723511 2008 Avian sarcoma virus and human immunodeficiency virus, type 1 use different subsets of ESCRT proteins to facilitate the budding process.
18539118 2008 Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17010938 2006 RILP interacts with VPS22 and VPS36 of ESCRT-II and regulates their membrane recruitment.
16973552 2006 Human ESCRT-II complex and its role in human immunodeficiency virus type 1 release.
16889659 2006 Genetic structure and evolution of the Vps25 family, a yeast ESCRT-II component.
16856878 2006 CHMP7, a novel ESCRT-III-related protein, associates with CHMP4b and functions in the endosomal sorting pathway.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16371348 2006 Degradation of endocytosed epidermal growth factor and virally ubiquitinated major histocompatibility complex class I is independent of mammalian ESCRTII.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15755741 2005 Eap45 in mammalian ESCRT-II binds ubiquitin via a phosphoinositide-interacting GLUE domain.
15511219 2005 Human CHMP6, a myristoylated ESCRT-III protein, interacts directly with an ESCRT-II component EAP20 and regulates endosomal cargo sorting.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15218037 2004 The human endosomal sorting complex required for transport (ESCRT-I) and its role in HIV-1 budding.
15007060 2004 Misfolding diverts CFTR from recycling to degradation: quality control at early endosomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14519844 2003 Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.
14505570 2003 The protein network of HIV budding.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278625 2001 Cloning and characterization of ELL-associated proteins EAP45 and EAP20. a role for yeast EAP-like proteins in regulation of gene expression by glucose.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.