Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.13
PubTator Score 2.64

Knowledge Summary

Patent (195)

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.5e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
lung cancer 4740 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.300 1.5e-05

AA Sequence

MTHTLYPTPFALYPINISAAWHLGPLPVSCFVSNKYQCSLAFGATTGLRVLVVVVPQTQLSFLSSLCLVS      1 - 70
LFLHSLVSAHGEKPTKPVGLDPTLFQVVVGILGNFSLLYYYMFLYFRGYKPRSTDLILRHLTVADSLVIL     71 - 140
SKRIPETMATFGLKHFDNYFGCKFLLYAHRVGRGVSIGSTCLLSVFQVITINPRNSRWAEMKVKAPTYIG    141 - 210
LSNILCWAFHMLVNAIFPIYTTGKWSNNNITKKGDLGYCSAPLSDEVTKSVYAALTSFHDVLCLGLMLWA    211 - 280
SSSIVLVLYRHKQQVQHICRNNLYPNSSPGNRAIQSILALVSTFALCYALSFITYVYLALFDNSSWWLVN    281 - 350
TAALIIACFPTISPFVLMCRDPSRSRLCSICCRRNRRFFHDFRKM                             351 - 395
//

Text Mined References (6)

PMID Year Title