Property Summary

NCBI Gene PubMed Count 3
PubMed Score 22.39
PubTator Score 7.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

AA Sequence

MSAPPALQIREANAHLAAVHRRAAELEARLDAAERTVHAQAERLALHDQQLRAALDELGRAKDREIATLQ      1 - 70
EQLMTSEATVHSLQATVHQRDELIRQLQPRAELLQDICRRRPPLAGLLDALAEAERLGPLPASDPGHPPP     71 - 140
GGPGPPLDNSTGEEADRDHLQPAVFGTTV                                             141 - 169
//

Text Mined References (5)

PMID Year Title