Property Summary

NCBI Gene PubMed Count 350
PubMed Score 550.72
PubTator Score 667.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (14)

Gene RIF (410)

PMID Text
27434945 ESR1 and VKORC1 single nucleotide polymorphisms were used to determine the vitamin K dosage in patients with ulcer-related hemorrhage.
26939421 There was no difference in distribution of polymorphic genes ESR1 and VKORC1 in peptic ulcer hemorrhage patients of both sexes, with the exception of A/A VKORC1 genotype found in women.
26781925 presence of CYP2C9*3 or VKORC1*2 gene polymorphism were associated with decrease in acenocoumarol dose requirements
26757860 Patients with VKORC1-1639A allele were more likely to require lower doses of both drugs than patients with the G allele (Odds ratio [OR] for acenocoumarol 9.06, and OR for warfarin = 18.7).
26600534 Our meta-analysis provides strong evidence that two SNPs in the VKORC1 gene, rs2359612 and rs9923231, contribute to the risk of cardiovascular and cerebrovascular diseases.
26583785 This study explored the correlations of VKORC1-1639 G/A, 1173 C/T and 497 T/G genetic polymorphisms with warfarin maintenance dose requirement in patients undergoing cardiac valve
26513304 A protein homology model of human VKORC1 was constructed to elucidate the binding modes of vitamin K 2,3-epoxide, R-warfarin, & S-warfarin in wild-type & mutant VKORC1 enzymes. Structural analysis of each model in conjunction with automated in-silico docking, provided a mechanism that explains warfarin resistance associated with the Val66Met & other VKORC1 polymorphisms.
26505400 we identified differences in the frequency distribution in the Tibetan population located in the ALOX5 , VKORC1 and PTGS2 genes
26445138 VKORC1 1173C>T and VKORC1 -1639G>A gene polymorphisms are associated with stable warfarin maintenance dose and adverse events of warfarin therapy.
26422867 VKORC1 genotypic data-based dose prediction alone does not accurately predict warfarin dose requirements in some Malaysian patients.
26167638 In this study, we investigated two VKORC1 gene polymorphisms, -1639G/A and 1173C/T, for effects on warfarin maintenance dosage in valvular heart disease (VHD) patients
26050796 Our algorithm achieved a determination coefficient of 40% including the variables age, gender, weight, height, self-declared race, amiodarone use, enzyme inducers use, VKORC1 genotypes and predicted phenotypes according to CYP2C9 polymorphisms
26040031 The association has been found between the ischemic atherothrombotic stroke and polymorphic variants of genes MGP and VKORC1.
26024874 Polymorphisms in VKORC1 gene is associated with warfarin dose changes in different race during venous thromboembolism.
25885753 After biomechanical aortic valve replacement, warfarin resistance caused by VKORC1 gene mutation.
25863101 The -1639G/A polymorphism of VKORC1 gene is associated with atrial fibrillation in the Uygur population but not in Hans.
25796943 Association of left atrial appendage thrombosis in patients with chronic atrial fibrillation with VKORC1 polymorphism.
25699611 Genetic polymorphisms in VKORC1, CYP2C9 along with age and height are determinants of warfarin dose requirements in Egyptian population acute coronary syndrome.
25594941 Eliminating the influence from environment factors , rs9923231 and rs1057910 in VKORC1 could explain about 32.0% of the variability in warfarin maintenance dose; rs7294 could explain 26.7% of the variability in plasma concentration.
25592578 performed tests of association between five common VKORC1 SNPs and two different measurements of vitamin K levels, dietary (n=5,725) and serum (n=348), in the Third National Health and Nutrition Examination Studies (NHANES III)
25560189 VKORC1 haplotype analysis revealed that most natives can be grouped into haplotypes H1 or H7-H8, while Mestizos showed a wider frequency distribution for other haplotypes.
25521356 Our study of 250 cases of major bleeding found that CYP2C9*3 (OR: 2.05, 95% CI [1.04,4.04]), but not CYP2C9*2, VKORC1 or CYP4F2, increased the risk of major bleeding
25519826 VKORC1 rs9923231 polymorphism had the highest impact on acenocoumarol daily dose in a South Indian population.
25492821 VKORC1 and CYP2C9 are two genes responsible for warfarin metabolism.
25356900 Around 42.5% of the overall interindividual variability in warfarin dose requirements was explained : VKORC1 genotype accounted for 29.6%, CYP2C9 genotype for 4.3%, age for 3.6%, the CYP4F2 genotype for 3.3%, and CAR/HNF4alpha (rs2501873/rs3212198) for 1.7%
25318916 Due to the combination of frequent alleles CYP2C9*2, CYP2C9*3 and VKORC1*2 in Slovak population we determine that 25% of population need a standard 5-mg daily dose of warfarin, while 44%, 23%, and 8% need 4 mg, 3 mg and 2 mg of warfarin per day
25179312 In VKORC1-wildtype infants, there was a higher intraventricular hemorrhage risk compared to carriers of the -1639A allele. Levels of the vitamin K-dependent coagulation parameters did not differ between VKORC1-wildtype and -1639A alleles.
25155935 VKORC1 variant (-1639A) was shown to be prevalent amongst Tibeto-Burmans, whereas CYP2C9 (R144C, I359L) and CYP4F2 (V433M) variants were observed in considerable variability amongst Indo-Europeans
25142093 in carriers of CYP2C9 gene variations, the interference with the VKA metabolism is modified by PPI co-medication and the VCKORC1 genotype.
24978953 VKORC1S1639 GG and the wild type CYP2C9*1*1genotypes are associated with the high-dose requirement for warfarin therapy.
24974237 The presented data are consistent with previous studies that have pointed to the dominant impact of VKORC1 gene polymorphisms on stable maintenance dose.
24966969 Report high resolution melting method to detect single nucleotide polymorphism of VKORC1 in patients of Han ethnic group.
24963046 VKORC1 exits the ER membrane by cellular quality control systems and results in the observed VKCFD2 phenotype.
24962733 Polymorphisms in VKORC1 (involved in the vitamin K cycle), are considered to be responsible for the variability in the individual daily dose requirement in Thromboembolic diseases treatment.
24956252 In addition to VKORC1 and CYP2C9, CYP4F2 gene has a slight but significant role in reaching INR >2.5 during the first weeks of acenocoumarol therapy.
24939302 Findings suggest that the vitamin K epoxide reductase complex subunit 1 (VKORC1)protein could inhibit calcium oxalate (CaOx) salt crystallization, adhesion and aggregation.
24919870 genetic polymorphism is associated with acenocoumarol treatment safety in patients with atrial fibrillation or venous thromboembolism
24911077 distribution of INR was influenced by variants in CYP4F2 rs2108622, CYP2C9*3, rs9332230, VKORC1 1173C>T, -1639G>A, rs55894764, ABCB1 rs2032582, rs1128503, rs1045642 and F5 rs6025, age, smoking and concomitant drugs
24858991 The frequency of CYP2C9, CYP4F2, and VKORC1 polymorphisms in Russian patients with thrombosis is comparable with other European ethnic groups.
24855061 Chronic kidney disease patients with the CG/GG genotype of VKORC1 had a higher risk of coronary artery calcification progression and a poorer survival.
24838629 Identification of VKORC1 genotype leading to resistance to tecarfarin
24797541 allele frequency of the studied genes was CYP2C9*2 (0.085), CYP2C9*3 (0.12), VKORC1 1173T (0.52), and VKORC1 -1639A (0.54)
24790995 This is the first method that is able to infer VKORC1 haplotypes using only conventional PCR methods.
24708259 Meta-analysis indicated that the VKORC1-1639G > A genetic polymorphism is associated with the variation of interindividual warfarin dose requirement in different ethnic populations.
24602049 This study aimed to evaluate the effect of gene polymorphisms of CYP2C9, VKORC1, thrombomodulin (THBD) and C-reactive protein (CRP) on the risk of bleeding complications of warfarin at therapeutic INR in Korean patients with mechanical cardiac valves
24601977 our results confirm the importance of age and VKORC1/CYP2C9 variants to stable warfarin dose in children.
24593903 Data show that the allele frequencies of cytochrome P450 enzymes CYP2C9*2, CYP2C9*3 and CYP3A5*3 were found to be 0.162, 0.112 and 0.943 respectively, whereas vitamin K epoxide reductase complex subunit 1 (VKORC1 )- 1639A was 0.534.
24535562 Chinese Han individuals carrying the 1639G or 1173C allele might be at increased risk for ischemic cerebravascular disease.
24474498 VKORC1 genotype affected time to therapeutic INR and time to over-anticoagulation during the initiation of warfarin therapy. VKORC1-1639G/A caused 12.2 % of the dose variability.
24425227 Haplotype analysis was performed using Asp36Tyr and seven other VKORC1 markers in Ashkenazi and Ethiopian-Jewish and non-Jewish individuals.
24399734 Report effect of VKORC1 genotype on warfarin dosing in Indian patients.
24288433 The VKORC1 -1639G > A polymorphism is not a genetic determinant of ischemic stroke occurrence, age of onset, severity, or functional outcome of disease in a Greek population.
24287886 We summarize the known VKORC1 missense mutations causing warfarin resistance, explore possible underlying genetic mechanisms, and summarize similarities and differences between warfarin resistant VKORC1 variants in humans and rodents. [review]
24198402 Human herpesvirus 8 IL6 contributes to primary effusion lymphoma cell viability via suppression of cathepsin D interaction with VKORC1v2.
24029542 CYP2C9 (p=0.004) and VKORC1 (p=0.02) variant carriers required lower cumulative doses, and CYP4F2 carriers required higher doses (p=0.04) of warfarin to reach an INR of 2.0
23982176 We modeled hVKORC1 on the previously solved structure of a homologous bacterial enzyme and performed in silico docking of warfarin on this model.
23972066 Our data suggest that the vitamin K epoxide reductase complex subunit 1 -1639G>A gene polymorphism is unlikely a major risk factor for patients with either central or branch retinal vein occlusion.
23932037 In this review, the VKORC1 c.-1639G>A genotype is a sensitive indicator for the risk of warfarin hemorrhagic complications.
23928870 The results of the present study suggest that the capacity of dietary vitamin K intake to influence warfarin dose requirements during anticoagulation therapy is VKORC1 genotype-dependent, at least in part.
23928358 The involvement of VKORC1L1 in VKOR activity partly explains the low susceptibility of some extrahepatic tissues to vitamin K antagonists.
23918929 The vitamin K oxidoreductase is a multimer that efficiently reduces vitamin K epoxide to hydroquinone to allow vitamin K-dependent protein carboxylation.
23800980 VKORC1-1639G>A and CYP2C9 polymorphisms contribute to the difference in warfarin dose requirements and quality of anticoagulation amongst Egyptian patients.
23774101 Variant alleles carry elevated risk of major bleeding events during warfarin treatment.
23771743 study indicated that the VKORC1 -1639G>A polymorphism plays a role in the response to acute vitamin K supplementation in over-anticoagulated patients, with faster decrease of INR value in patients carrying the G allele.
23732872 the VKORC1-1639G>A SNP may increase susceptibility to ossification of the posterior longitudinal ligament in women
23726967 The study identifies common polymorphisms limked to warfarin resistance and sensitivity in the VKORC1, CYP2C9 and CYP4F2 genes.
23710884 analysis of mutant VKOR shows that it has a role in vitamin K-dependent carboxylation with vitamin K epoxide (KO) as substrate
23703341 VKORC1 1173C>T polymorphism (TT genotype) was associated with osteoporosis and calcified plaques in the carotid artery in patients referred for BMD measurement
23691226 Novel associations of VKORC1 variants with higher acenocoumarol requirements.
23677510 The effect of CYP2C9, VKORC1 and CYP4F2 polymorphism and of clinical factors on warfarin dosage during initiation and long-term treatment after heart valve surgery.
23586031 The low frequency of the CYP2C9 *3 allele combined with the absence of subjects carrying 2 defective CYP2C9 alleles suggests that, in this specific population, pharmacogenetic COAs dosing may mostly rely upon VKORC1 genotyping.
23571513 warfarin resistant VKORC1 Asp36Tyr appears to be confined to north-eastern Africa and nearby Middle-Eastern populations, but in those populations where it is present, it has a significant influence on warfarin dose requirement
23563037 Genotype frequency of CYP2C9 and VKORC1 SNPs is variable among the two ethno-geographically distinct Indian populations; this could translate into diverse warfarin response and risk of bleeding episodes
23481074 The study findings point towards the role of CYP2C9 and VKORC1 gene polymorphisms in determining the inter-individual dose variability of acenocoumarol in the Indian patients with mechanical heart valve replacement.
23473641 The genetic polymorphisms of CYP2C9 and VKORC1 results in decreased requirement of daily maintenance dose of acenocoumarol.
23452238 Ranked IC50 values from the cell culture-based assay accurately reflect elevated warfarin dosages for patients with VKORC1 missense mutation-associated warfarin resistance
23362849 VKORC1 polymorphisms seem not to be related with the thrombotic state of systemic and ocular Behcet's disease.
23287317 This study shows significant association between CYP2C9 polymorphic alleles and phenytoin toxicity in this study population.
23285254 It is not possible to determine if VKORC1 or one of the three other genes is the target of this strong positive selection that could explain present-day differences among human populations in antivitamin K dose requirement.
23279643 Letter: CYP2C9 and VKORC1 genotypes both have a significant effect on the anticoagulation response at an early stage of warfarin initiation in children.
23201087 Large interindividual variability in acenocoumarol maintenance dose due to CYP2C9*2, CYP2C9*3 and VKORC1 -1639G>A polymorphisms.
23183958 In children with heart disease, VKORC1 genotypes, age, and target INR are important determinants influencing warfarin dosing in children with heart disease.
23159639 the stable therapeutic dose of acenocoumarol is dependent of patient's age, the presence of the CYP2C9*3 allele and c.-1639G>A polymorphism of VKORC1.
23154637 miR-133a appears to have a direct regulatory effect on expression of VKORC1 in humans.
23124848 Genetic variants in VKORC1, which are involved in vitamin K reduction and associated with deep venous thrombosis, correlate with systemic lupus erythematosus (SLE) development in Asian subjects. These results suggest that there may be intersecting genetic pathways for the development of SLE and thrombosis.
23113310 CYP2C9 and VKORC1 gene polymorphisms are not essential for bleeding development under conditions of oral application of anticoagulant acenocoumarol in Russian patients at high risk of thromboembolic complications.
23065265 The VKORC1 1639 G>A and CYP2C9 mutation prevalence and allele frequency of the current results from two different populations (Sivas and Canakkale) showed similarly very variable profiles when compared to the other results from the Turkish population.
23039877 Wild-type VKORC1 and its spontaneous mutants were expressed in Pichia pastoris and susceptibility to VKA was assessed by the in vitro determination of kinetic and inhibition constants
23018470 These result show that single nucleotide polymorphisms of VKORC1 exerted no significant effects on baseline coagulation activity assessed by fully carboxylated plasma normal prothrombin (NPT)
22952875 Influence of CYP2C9 and VKORC1 on patient response to warfarin, is reported.
22923610 human VKOR is a three-TMD protein. Moreover, the conserved loop cysteines apparently play different roles in human VKOR and in its bacterial homologues.
22915323 rs2359612C was associated with a higher risk of CAD in the presence of coronary calcification (CAC) and a higher incidence of cardiovascular events in CAD patients with CAC, but a lower coronary calcification
22871975 Among 16 heterozygous D36Y carriers (minor allele frequency = 3.8%), warfarin weekly dose was increased by a median of 43.7 mg (IQR, 40.5 to 47.2 mg) compared to non-carriers.
22864379 VKORC1 promoter polymorphism c.-1639 G > A influences the pharmacokinetic properties of phylloquinone.
22855348 For low-dose warfarin treatment, the VKORC1-1639 G > A and CYP2C9 genotype variations affected the pharmacokinetics and pharmacodynamics of warfarin.
22854539 Functional polymorphisms in CYP2C9, CYP4F2 and VKORC1 genes affect response to warfarin dose in an admixed Omani patient cohort.
22808915 CYP2C9 and VKORC1 polymorphisms are differently distributed according to self-declared ethnicity or genetic ancestry in the Brazilian general population plus Amerindians
22592842 VKORC-1 polymorphism is associated to a different warfarin dosage, anticoagulation level, time spent outside the therapeutic range and, in the long-term, a different incidence of atherothrombotic events.
22571356 Polymorphisms in VKORC1 have more impact than CYP2C9 polymorphisms on early warfarin International Normalized Ratio control and bleeding rates.
22534826 Report algorithm predicting warfarin dose in Chinese Han patients with valvular atrial fibrillation based on CYP4F2/CYP2C9/VKORC1 polymorphisms.
22533669 Data indicate that VKORC1 TT and CYP2C9*2\*2 were associated with a significantly lower warfarin dose.
22528326 The multiple linear regression model including VKORC1-1639G>A, CYP2C9, CYP4F2 and clinical factors (body surface area (BSA) and age) could explain 42 % of the variance in the warfarin maintenance dose.
22496424 These findings establish VKOR as a significant contributor to disulfide bond formation within the endoplasmic reticulum.
22452429 The researchers evaluated the prevalence of the VKORC1 polymorphism in a population of Omanis.
22409277 There are no interactions between the CYP2C9 and VKORC1 genotypes affecting the maintenance dose, time to severe over-anticoagulation and time to achieve stability for phenprocoumon and acenocoumarol.
22394334 It was found that subjects with the vitamin K epoxide reductase complex subunit 1 GG and CC genotypes had a higher risk of retinal vein occlusion.
22393834 Bai Chinese have significant higher A-allele frequency of VKORC1
22349464 The algorithm including VKORC1 3730 G > A, associated with warfarin resistance, allowed a more accurate identification of resistant patients who require higher warfarin dosage.
22290467 The frequencies of CYP2C9 and VKORC1 alleles found in an Argentinian population are similar to those reported in other populations of Caucasian origin
22252093 Knowledge of the patient's CYP2C9/VKORC1 genotype might assist physicians in adjusting acenocoumarol doses in the first month(s) of therapy.
22198820 The present study indicated that VKORC1, CYP4F2, and CYP2C9 genotypes and interacting drugs had a significant impact on the warfarin maintenance dose in Chinese patients with heart valve replacement
22188360 Quantitative PCR assays for VKORC1, CYP4F2, GGCX and CALU identified two copies in all populations.
22173503 Decreased expression of VKORC1 may contribute to the development of calcium oxalate urolithiasis in the kidney.
22130800 VKORC1 polymorphisms are associated with variability in warfarin dose requirement.
22130532 gp130 signaling was unaffected by VKORC1v2 or vBD overexpression or by VKORC1v2 depletion, suggesting an alternative pathway of vIL-6 activity via VKORC1v2
22075505 The CYP2C9*3 allele and old age (>/= 75 years) with the VKORC1 1173 T allele were associated with increased risk of over-anticoagulation.
22023024 warfarin response in Chinese ... in the allelic frequencies of VKORC1
22010099 VKORC1 and CYP2C9 polymorphisms are associated with variability in warfarin dose requirement.
21939388 The results indicate that VKORC1 in eukaryotes in the respective native environments, employ apparently different mechanisms for electron transfer.
21883387 Impact of genetic factors (VKORC1, CYP2C9, CYP4F2 and EPHX1) on the anticoagulation response to fluindione
21800014 no association between haplotypes and venous thrombosis
21767890 Report independent association between VKORC1 -1639 G>A polymorphism and maximum carotid intima-media thickness in T2DM patients which is likely due to atherosclerosis characterized by increased calcification.
21766908 described drug abuse cases suggest that an association between the presence of CYP2C and VKORC1 allelic variants and cocaine-induced interstitial lung damage is highly likely
21725053 After adjustment for covariates, time to stable anticoagulation was not influenced by VKORC1 or CYP2C9 genotype.
21651319 Pharmacogenetics of coumarin dosing: prevalence of CYP2C9 and VKORC1 polymorphisms in the Lebanese population.
21639946 CYP2C9 and VKORC1 genetic variants as well as non-genetic factors such as age, body weight and body height account for 15.4% of variance in warfarin dose among our study population.
21638223 Extreme sensitivity to acenocoumarol therapy in patient with both VKORC.-1639 A/A and CYP2C9*1/*3 genotypes.
21562135 Absence of novel CYP4F2 and VKORC1 coding region DNA variants in patients requiring high warfarin doses.
21544933 CYP2C9 and VKORC1 gene polymorphism is not associated with the development of severe hypocoagulation episodes in patients treated with acenocoumarol.
21362126 endoplasmic reticulum loop VKORC1 substitutions cause warfarin resistance but do not diminish gamma-carboxylation of the vitamin K-dependent coagulation factors
21248432 VKORC1 -1639 G>A allele is present at moderately high frequency in the Northern Indian population, and frequencies of CYP2C9*2 and CYP2C9*3 alleles are also found to be different from other populations
21215088 Both gene polymorphisms of CYP450 2C9*3 + 1075C/A and VKORC1-1639A/G significantly affected the maintaining dose of warfarin in the Chinese population.
21179439 analysis of VKORC1 common variation and bone mineral density in the Third National Health and Nutrition Examination Survey
21179214 analysis of VKORC1 pharmacogenetics and pharmacoproteomics in patients on warfarin anticoagulant
21176721 The VKORC1 (1173C > T) polymorphism might be very important, and its contribution can be equally explained by the VKORC1(-1639 G > A) polymorphism for warfarin dose requirements in Han Chinese patients.
21148049 This study showed that both CYP2C9 and VKORC1 polymorphisms are common in Lebanon and influence warfarin and acenocoumarol dose requirements, with the CYP2C9*2 polymorphism having less effect on acenocoumarol.
21127708 Results indicate that pharmacogenetic testing for VKORC1*2, CYP2C9*2 and CYP2C9*3 polymorphisms is more informative regarding warfarin dose requirements than testing for VKORC1*3, VKORC1*4, and CYP4F2 (1347 C > T) polymorphisms.
21110192 VKORC1 and CYP2C9 polymorphism contribute to the difference dose requirement amongst the patients .
21103663 Report VKORC1 itself, its paralog VKORC1L1, emopamil binding protein (EBP) and stress-associated endoplasmic reticulum protein 1 (SERP1) as interaction partners for VKORC1.
21063236 Phenprocoumon maintenance dosage depended on polymorphisms in the VKORC1 gene. CYP2C9 and CYP4F2 were of modest relevance.
21063236 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21057703 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21044367 Observational study of gene-disease association. (HuGE Navigator)
20978134 role for Cys-43 and Cys-51 in catalysis, suggesting a relay mechanism in which a redox protein transfers electrons to these loop residues, which in turn reduce the membrane-embedded Cys132-Cys135 disulfide bond to activate VKOR
20946155 Oral anticoagulant resistance mutations of VKORC1 predispose afflicted patients to high oral anticoagulant dosage requirements.
20946155 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20930419 Patients with the VKORC1 BB haplotype and CYP2C9*1/*1 required about twice the warfarin dose compared to those with the VKORC1 AA haplotype and CYP2C9*1/*1.
20930419 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20885015 Findings indicated both similarities and differences in the distribution of polymorphic alleles of CYP2C9, CYP2C19 and VKORC1 between southern and northern Iranians
20885015 Observational study of genotype prevalence. (HuGE Navigator)
20860466 VKORC1 polymorphisms in Brazilians: comparison with the Portugese and Portugese- speaking Africans and pharmacogenetic implications are reported.
20860466 Observational study of genotype prevalence. (HuGE Navigator)
20854800 Observational study of genetic testing. (HuGE Navigator)
20842355 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20833980 Polymorphisms in VKORC1 is not associated with dosing of vitamin K antagonists in thrombosis.
20833980 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20833655 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20831047 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20811787 Observational study of gene-disease association. (HuGE Navigator)
20733952 Observational study of genetic testing. (HuGE Navigator)
20716240 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20709439 Decreased kidney function was associated with lower warfarin dose requirements independently of CYP2C9 and VKORC1 genotype and clinical factors.
20709439 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20696932 VKOR employs the same electron transfer pathway as its bacterial homologs and VKORs generally prefer membrane-bound thioredoxin-like redox partners
20653676 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20653674 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20637959 CYP2C9, and VKORC1 had significant effects on warfarin maintenance dose requirements.
20637959 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20621035 These findings suggested that polymorphisms of VKORC1 may play a role in osteoporosis.
20621035 Observational study of gene-disease association. (HuGE Navigator)
20615525 The presence of the rare VKORC1 V66M in two warfarin high dose outlier patients implies that this variant may be more frequent among African Brazilians and has implications for future warfarin studies in other populations of African descent.
20615525 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20597268 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20585834 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20585445 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20581661 Carriers of AA genotype were more likely to be overanticoagulated during follow-up after initiation of VKA when compared with carriers of the GA and GG genotypes
20581661 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20579077 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20575749 Observational study of gene-disease association. (HuGE Navigator)
20569971 Letter: Algorithms using clinical and genetic data (CYP2C9, VKORC1) are relevant to predict warfarin dose in patients with different INR targets.
20569971 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20555338 four genetic polymorphisms known to influence warfarin dosing (VKORC1 rs9923231, CYP2C9 rs1799853, CYP2C9 rs1057910 and CYP4F2 rs2108622)
20555338 Observational study of genotype prevalence. (HuGE Navigator)
20553802 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20532885 Observational study of gene-disease association. (HuGE Navigator)
20504253 Observational study of genotype prevalence. (HuGE Navigator)
20499136 Significant associations with warfarin dose were seen for VKORC1 -1639, CYP2C9*2 and *3, the CYP4F2 SNP, and VKORC1 3730
20499136 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20488169 Observational study of genotype prevalence. (HuGE Navigator)
20459419 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20442691 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
20434758 VKORC1 c.-1639G > A variant is not likely to be associated with hepatic or portal vein thrombosis.
20434758 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20421126 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20386359 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20381283 Observational study of gene-disease association, gene-environment interaction, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
20376629 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20359285 Review and summary comparison of values of the Michaelis-Menten constant, maximal velocity and intrinsic clearance for 84 substrates reportedly mediated by major variants of CYP2C9 call for standardization in assessment of enzyme kinetics.
20354686 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20339978 VKORC1 genotype and CYP2C9 polymorphism affect daily dose requirements and time to therapeutic INR in Turkish patients receiving warfarin for anticoagulation.
20339978 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20339191 Observational study of gene-disease association, gene-environment interaction, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
20228265 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20226775 Observational study of genetic testing. (HuGE Navigator)
20210733 Observational study of genotype prevalence. (HuGE Navigator)
20204461 Observational study of gene-disease association, gene-environment interaction, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
20203262 Single VKORC1 polymorphism is associated with dose across 3 racial groups.
20203262 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20193673 Subtle polymorphisms, including those in GGCX, NQO1, and VKORC1 genes, influence individual susceptibility to the development of atherosclerotic stroke.
20193673 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20163834 The study shows the occupancy of human RNA polymerase II and c-Myc on VKORC1 promoter, studied by ChIP-qPCR using antibodies against these proteins.
20149073 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20121287 Genotyping of four SNPs for VKORC1 and CYP2C9 polymorphisms is useful in predicting a high probability of the occurrence of DAH in patients receiving oral anticoagulants.
20075209 Observational study of genetic testing. (HuGE Navigator)
20073138 Observational study of genotype prevalence. (HuGE Navigator)
20072124 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20043560 There was a high prevalence of the VKORC1 haplotype AA and AB in a group of Thai patients with heart valve disease who took warfarin.
20043560 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20020283 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19958090 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19942260 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19941044 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19875892 VKORC1 -1639 G>A gene polymorphism may explain at least in part the low responsiveness to acenocoumarol.
19875892 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19874474 Although CYP2C9 and VKORC1 genotypes were significant independent predictors of therapeutic dose at each weekly interval, the magnitude of their predictive ability diminished over time.
19874474 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19842934 VKORC1 haplotypes in five East-Asian populations and Indians are reported.
19842934 Observational study of genotype prevalence. (HuGE Navigator)
19794411 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19781295 VKORC1 polymorphisms are associated with differences in the initial response to warfarin when given at fixed doses, without affecting, as expected, its plasma concentration.
19780415 VKORC1 polymorphism influenced anticoagulants dose and predicted individuals predisposed to unstable anticoagulation.
19780415 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19745563 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19738376 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19663669 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19652895 Polymorphisms in VKORC1 and GGCX are not major genetic determinants of vitamin K-dependent coagulation factor activity in Western Germans.
19652895 Observational study of gene-disease association. (HuGE Navigator)
19578179 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19567378 A stepwise multivariate linear regression analysis showed that 38.2% of the warfarin dose response variance was accounted for by a model involving age (20.9%), VKORC1-1639G/A (11.3%), and CYP2C9*1, *2, and *3 variants (7.1%)
19545555 Observational study of genetic testing. (HuGE Navigator)
19538716 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19530970 VKORC1 haplotypes in healthy Hungarian and Roma population samples are reported.
19530970 Observational study of genotype prevalence. (HuGE Navigator)
19436136 VKORC1 rs8050894 GG homozygotes had significantly higher measures of plasma phylloquinone than carriers of the CG or CC genotypes and carriers of VKORC1 rs7294 AA or AG had significantly lower plasma phylloquinone concentrations
19387626 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19376320 VKORC1 genotype is associated with cardiovascular events in patients with DES implantation, suggesting the role of coagulation system.
19376320 Observational study of gene-disease association. (HuGE Navigator)
19324988 Observational study of genetic testing. (HuGE Navigator)
19320825 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
19319511 The data suggest a fundamental role of VKORC1 haplotypes in the anticoagulation property of phenprocoumon.
19319511 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19300499 warfarin dose variance is explained by single nucleotide polymorphisms in VKORC1, CYP2C9, and CYP4F2
19300499 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19297219 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19233910 Observational study of genetic testing. (HuGE Navigator)
19225451 The risk of severe overanticoagulation is increased in individuals with a genetic variation of VKORC1 that contain additional T-alleles.
19225451 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19207028 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19181737 Observational study of genetic testing. (HuGE Navigator)
19177029 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19172700 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
19139476 VKORC1 single nucleotide polymorphism(SNP)s have been identified that influence warfarin metabolism and sensitivity, including SNP variants in VKORC1 which influence individual sensitivity to a given dose of warfarin.
19135231 The VKORC1 polymorphism, body weight, age, and serum albumin were found to affect the inter-individual variability. The dosing algorithm of warfarin maintenance dose was investigated by multivariate linear regression.
19135231 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19124480 VKORC1 +2255 genotype revealed stronger inverse associations between dietary intake of methaquinones and risk of prostate cancer in homo- and heterozygous carriers of the A allele compared with GG carriers.
19124480 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19117406 Observational study of genetic testing. (HuGE Navigator)
19099951 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19077919 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19074728 much of the information provided by CYP2C9 and VKORC1 genotypes during warfarin initiation is captured by the early international normalized ratio response
19074728 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19034590 Preoperative screening for the VKORC-1 genotype could identify joint replacement arthroplasty patients with a greater potential for being a hyperresponder or hyporesponder to warfarin
19034590 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19025725 results show that the inverse association between dietary vitamin K intake and serum ucOC depends on a functionally relevant allelic variant of the VKORC1 gene.
19025725 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19018719 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19018718 Observational study of genotype prevalence. (HuGE Navigator)
18950464 The risk of gastrointestinal bleeding during acenocoumarol therapy in carriers of any of the studied polymorphisms is severely increased with exposure to weekly doses of acenocoumarol higher than 15 mg or the use of amiodarone or aspirin.
18950464 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18855533 VKORC1 polymorphisms, haplotypes and haplotype groups on warfarin dose among African Americans and European Americans are reported.
18855533 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18848323 Observational study of gene-disease association. (HuGE Navigator)
18841283 Our data do not confirm the association between polymorphism in the VKORC1 gene and stroke in the German population
18841283 Observational study of gene-disease association. (HuGE Navigator)
18826394 study in European patients with CHD and CVD did not show any association between SNP +2255 in VKORC1 and cardiovascular disease, as opposed to findings in a Chinese population and a French study in patients with venous thromboembolism
18826394 Observational study of gene-disease association. (HuGE Navigator)
18813101 VKORC1 haplotypes may play a role in the long-term renal allograft function but these findings need to be replicated in prospective clinical studies.
18813101 Observational study of gene-disease association. (HuGE Navigator)
18805772 Mutations in the VKORC1 gene affect the sensitivity of the epoxy reductase enzyme for warfarin. The three main haplotypes of VKORC1 gene, *2, *3, *4, explain most of the genetic variability in warfarin dose among Caucasians.
18805772 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18781852 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18754001 Observational study of gene-disease association. (HuGE Navigator)
18698879 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18690342 genetic variation in VKORC1 appears to have a different influence than CYP2C9 on anticoagulation-related outcomes such as bleeding events and time in therapeutic range of warfarin
18690342 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18680736 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18680536 Mutations associated with warfarin resistance do not cause a discernible defect in VKORC1 reductase function
18680536 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18629445 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18574025 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18559094 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18542936 VKORC1 polymorphisms are associated with warfarin dose requirements in Turkish patients.
18542936 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18535201 Warfarin dosing is correlated with polymorphisms in VKORC1 and the CYP2C9 genes
18535201 Genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18532998 Multiple genetic alterations in vitamin K epoxide reductase complex subunit 1 gene (VKORC1) can explain the high dose requirement during oral anticoagulation.
18523153 SNPs to -1639G>A and 1173CA, and the tightly linked intron1 SNP 1173C>T, predict warfarin dose more accurately than intron 2 SNP 1542G>C in blacks.Increased warfarin dose requirement in blacks was accounted for by lower frequency of the -1639 A allele
18523153 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18516070 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18480003 Observational study of genetic testing. (HuGE Navigator)
18466315 effect of VKORC1 genotype on vitamin K-induced alterations in the anticoagulation response
18466315 Observational study and clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18466099 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18449434 No clear link waqs found between VKORC1 genetic polymorphism and the risk of venous thrombosis or peripheral arterial disease.
18370846 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18322281 Initial variability in the INR response to warfarin was more strongly associated with genetic variability in the pharmacologic target of warfarin, VKORC1, than with CYP2C9.
18322281 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18305455 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18281915 Observational study of pharmacogenomic / toxicogenomic and genetic testing. (HuGE Navigator)
18252229 Observational study of genotype prevalence. (HuGE Navigator)
18240904 Single nucleotide polymorphisms show significant differences between ethnic groups and are associated with warfarin dose requirements for achieving a recommended International Normalized Ratio range in Japanese cardiovascular surgery patients.
18240904 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18218987 Persons with at least one 1173C>T-allele had a statistically significant 19% (95% CI 2 to 40%) risk increase of calcification of the aortic far wall compared to CC homozygous persons, adjusted for age and gender.
18218987 Observational study of gene-disease association. (HuGE Navigator)
18183038 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18034619 T allele of VKORC1 1173C>T SNP (tag-SNP of H1-H2 haplotypes) is highly associated with low mean weekly warfarin dose.
18034619 Observational study of gene-disease association. (HuGE Navigator)
18034618 VKORC1 protein genotype was not associated with warfarin dose requirements in the African-Americans population.
18030307 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17995970 Warfarin dose requirements in Asian patients homozygous for VKORC1 H1 haplotype are significantly lower compared with patients homozygous for the H7 haplotype.
17995970 Observational study of genotype prevalence, gene-disease association, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17989110 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17961434 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17899045 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17883699 VKORC1 variants are not associated with arterial or venous thrombosis
17883698 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17883698 the VKORCI polymorphism may have a role in the pathogenesis of venous thromboembolism
17849045 Mutations and single nucleotide polymorphisms within the translated and non-translated regions of the VKORC1 gene have been shown to cause coumarin resistance and sensitivity, respectively.
17764537 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17721328 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17721328 VKORC1 (-1639) G/A genotyping might be necessary for patients with Factor V Leiden and/or prothrombin G2021A mutation before warfarin anticoagulant therapy.
17666014 VKORC1 gene variation may not have a role in venous thrombosis [commentary]
17653141 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17653141 VKORC1 genotype did not confer a significant increase in risk for hemorrhage in patients on warfarin.
17596133 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17549303 Observational study of gene-disease association. (HuGE Navigator)
17549303 study examined the potential association between the functional SNP rs9923231 & early-onset coronary heart disease (CHD)in Northern Germans; no evidence for a significant association was detected between VKORC1 genotype & CHD phenotype
17510308 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17413769 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17413769 VKORC1 haplotypes possibly are linked to some unidentified factors involved in the metabolic clearance of warfarin enantiomers
17391071 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17329985 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17325732 Observational study of gene-gene interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17301738 Observational study of gene-disease association. (HuGE Navigator)
17192772 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17192772 Results suggest that knowledge of both VKORC1 and CYP2C9 genotypes could contribute to a safer treatment with along acting anticoagulant phenprocoumom.
17189218 Observational study of gene-disease association. (HuGE Navigator)
17164330 Purified vitamin K epoxide reductase alone is sufficient for conversion of vitamin K epoxide to vitamin K and vitamin K to vitamin KH2.
17111199 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17110455 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17110455 Asp36Tyr is a new marker of the high end of the warfarin dosing range
17049586 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17049586 In addition to polymorphisms in VKORC1 and CYP2C9, we identified GGCX 8016G>A, resulting in the missense mutation R325Q, as a genetic determinant of warfarin maintenance dose in Japanese patients.
17048007 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17031720 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17015052 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16890578 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16879214 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16879214 VKORC1*2 is the most important haplotype for warfarin dosage in the Swedish population
16847429 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16815313 Observational study of gene-gene interaction and gene-environment interaction. (HuGE Navigator)
16700826 VKORC1 1173C>T could be responsible, atleast in part, for the higher sensitivity of Asian people to oral anticoagulants.
16677080 VKORC1 is the key protein of the vitamin K cycle [review]
16676068 Observational study of gene-disease association. (HuGE Navigator)
16634640 These data indicate that the effect of VKOR overexpression is limited in vivo, possibly because a carboxylation component like the redox protein becomes saturated or because another step is now rate-limiting.
16611750 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16611750 The association between single nucleotide polymorphisms (SNPs) in VKORC1 and CYP2C9 and average weekly warfarin dose was tested.
16611310 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16580898 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16549638 Observational study of gene-disease association. (HuGE Navigator)
16549638 subjects with the CC and CT genotypes had lower levels of undercarboxylated osteocalcin, and lower levels of protein induced in vitamin K absence or antagonism than those with TT genotypes
16513444 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16432637 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16424822 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16424822 VKORC1 and CYP2C9 polymorphisms contribute to inter-population difference in warfarin doses among Japanese, Caucasians and African-Americans
16420583 Population variation in VKORC1 haplotype structure.
16270630 the C132-X-X-C135 motif in VKORC1 comprises part of the redox active site that catalyzes VKO reduction and also suggest a crucial role for the hydrophobic Thr-Tyr-Ala motif in coumarin binding
16270629 Observational study of gene-disease association. (HuGE Navigator)
16201835 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16141794 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16030016 Overexpression of VKORC1 can be utilized for increased cellular production of recombinant vitamin K-dependent proteins.
15978113 a VKORC1 mutation is described in a patient with vitamin K antagonist resistance [case report]
15972850 VKOR is involved in angiogenesis.
15947090 Observational study of gene-disease association. (HuGE Navigator)
15947090 CYP2C9 and VKORC1 genotype have roles in determining response to warfarin therapy and therefore in blood coagulation
15930419 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15930419 VKORC1 haplotypes can be used to stratify patients into low-, intermediate-, and high-dose warfarin groups and may explain differences in dose requirements among patients of different ancestries.
15888487 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15883587 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15883587 VKORC1 single-nucleotide polymorphisms associated significantly with warfarin dose, and explain 29-30% of variance in dose.
15790782 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15790782 The simple genotyping of 2 single-nucleotide polymorphisms (SNPs), VKORC1 -1639G>A or 1173C>T and the CYP2C9*3 polymorphisms, could thus predict a high risk of overdose before initiation of anticoagulation with acenocoumarol
15630486 association between a nucleotide transition in VKORC1 and pharmacodynamic warfarin resistance supports the hypothesis that VKORC1 is the site of action of warfarin and indicates thatVKORC1 sequence is an important determinant of the warfarin dose response
15358623 Observational study of gene-disease association. (HuGE Navigator)
15358623 Genetic variants of the VKORC1 gene locus modulate the mean daily dose of drug prescribed to acquire the target anticoagulation intensity.
14765195 identification of the gene for VKOR based on specific inhibition of VKOR activity by a single siRNA pool
14765194 using a positional cloning approach that integrated mapping information from three species, the gene VKORC1 that is mutated in combined deficiency of vitamin-K-dependent clotting factors type 2 and warfarin resistance was identified

AA Sequence

MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVL      1 - 70
GQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYLAWILFFVLYDFCIVCITTYA     71 - 140
INVSLMWLSFRKVQEPQGKAKRH                                                   141 - 163
//

Text Mined References (354)

PMID Year Title
27434945 2016 [HORMONALLY-GENETICALLY DEPENDENT THERAPY, USING VITAMIN K IN PATIENTS, SUFFERING THE ULCER HEMORRHAGE].
26939421 2015 [HORMONAL-GENETIC SCREENING IN PATIENTS, SUFFERING GASTRODUODENAL ULCER HEMORRHAGE].
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26781925 2015 High prevalence of VKORC1*3 (G9041A) genetic polymorphism in north Indians: A study on patients with cardiac disorders on acenocoumarol.
26757860 2015 [Effect of VKORC1 and CYP2C9 variants on dosage of oral anticoagulants in Chilean individuals].
26600534 2015 VKORC1 rs2359612 and rs9923231 polymorphisms correlate with high risks of cardiovascular and cerebrovascular diseases.
26583785 2015 Effects of VKORC1 Genetic Polymorphisms on Warfarin Maintenance Dose Requirement in a Chinese Han Population.
26513304 2016 Warfarin resistance associated with genetic polymorphism of VKORC1: linking clinical response to molecular mechanism using computational modeling.
26505400 2015 Genetic polymorphisms in very important pharmacogenomic (VIP) variants in the Tibetan population.
26445138 2015 VKORC1 gene polymorphisms and adverse events in Croatian patients on warfarin therapy.
26422867 2015 VKORC1 and CYP2C9 genotypic data-based dose prediction alone does not accurately predict warfarin dose requirements in some Malaysian patients.
26167638 2015 VKORC1 -1639G/A and 1173 C/T Genetic Polymorphisms Influence Individual Differences in Warfarin Maintenance Dose.
26050796 2015 Development of a pharmacogenetic-based warfarin dosing algorithm and its performance in Brazilian patients: highlighting the importance of population-specific calibration.
26040031 2015 [Association of allelic polymorphisms of genes matrix Gla-protein system with ischemic atherothrombotic stroke].
26024874 2015 Race influences warfarin dose changes associated with genetic factors.
25885753 2015 Warfarin resistance due to VKORC1 gene mutation in a patient following mechanical aortic valve replacement with an ON-X valve.
25863101 2015 [Association of VKORC1 gene -1639G/A polymorphism with atrial fibrillation in ethnic Uygurs and Hans from Xinjiang].
25796943 2014 [Factors associated with thrombosis of the left atrial appendage in patients with chronic atrial fibrillation].
25699611 2015 Impact of CYP2C9 and VKORC1 genetic polymorphisms upon warfarin dose requirements in Egyptian patients with acute coronary syndrome.
25594941 2015 Warfarin dosage response related pharmacogenetics in Chinese population.
25592578 2015 Measures of exposure impact genetic association studies: an example in vitamin K levels and VKORC1.
25560189 2015 Genotype frequencies of VKORC1 and CYP2C9 in native and Mestizo populations from Mexico, potential impact for coumarin dosing.
25521356 2014 Genotype and risk of major bleeding during warfarin treatment.
25519826 2015 An acenocoumarol dosing algorithm exploiting clinical and genetic factors in South Indian (Dravidian) population.
25492821 2014 [Effect of genetic variations on adjusting of warfarin dose].
25356900 2015 Combined effects of hepatocyte nuclear factor 4? and constitutive androstane receptor on stable warfarin doses.
25318916 2014 Frequencies of polymorphisms in CYP2C9 and VKORC1 genes influencing warfarin metabolism in Slovak population: implication for clinical practice.
25179312 2014 Genetic variants of the vitamin K dependent coagulation system and intraventricular hemorrhage in preterm infants.
25155935 2014 Genetic epidemiology of pharmacogenetic variations in CYP2C9, CYP4F2 and VKORC1 genes associated with warfarin dosage in the Indian population.
25142093 2014 Influence of proton pump inhibitors and VKORC1 mutations on CYP2C9-mediated dose requirements of vitamin K antagonist therapy: a pilot study.
24978953 2016 VKORC1 and CYP2C9 genotypes in Egyptian patients with warfarin resistance.
24974237 2014 Prevalence of genetic polymorphisms of CYP2C9 and VKORC1 - implications for warfarin management and outcome in Croatian patients with acute stroke.
24966969 2014 High resolution melting method to detect single nucleotide polymorphism of VKORC1 and CYP2C9.
24963046 2014 The Arg98Trp mutation in human VKORC1 causing VKCFD2 disrupts a di-arginine-based ER retention motif.
24962733 2015 Meta-analysis of randomized controlled trials reveals an improved clinical outcome of using genotype plus clinical algorithm for warfarin dosing.
24956252 2014 Effect of VKORC1, CYP2C9 and CYP4F2 genetic variants in early outcomes during acenocoumarol treatment.
24939302 2014 Involvement of VKORC1 in the inhibition of calcium oxalate crystal formation in HK-2 cells.
24919870 2014 Pharmacogenetics role in the safety of acenocoumarol therapy.
24911077 2014 CYP2C9, VKORC1, CYP4F2, ABCB1 and F5 variants: influence on quality of long-term anticoagulation.
24858991 2013 The frequency of CYP2C9, VKORC1, and CYP4F2 polymorphisms in Russian patients with high thrombotic risk.
24855061 2014 Sequence variation in vitamin K epoxide reductase gene is associated with survival and progressive coronary calcification in chronic kidney disease.
24838629 2014 Identification of VKORC1 genotype leading to resistance to tecarfarin.
24797541 2014 Frequency of CYP2C9 and VKORC1 gene polymorphisms and their influence on warfarin dose in Egyptian pediatric patients.
24790995 2014 A new nested allele-specific multiplex polymerase chain reaction method for haplotyping of VKORC1 gene to predict warfarin sensitivity.
24708259 2014 The impact of VKORC1-1639G?>?A genetic polymorphism upon warfarin dose requirement in different ethnic populations.
24602049 2014 Association of gene polymorphisms with the risk of warfarin bleeding complications at therapeutic INR in patients with mechanical cardiac valves.
24601977 2014 The impact of age and CYP2C9 and VKORC1 variants on stable warfarin dose in the paediatric population.
24593903 2014 Genetic polymorphisms in warfarin and tacrolimus-related genes VKORC1, CYP2C9 and CYP3A5 in the Greek-Cypriot population.
24535562 2014 Association between VKORC1 gene polymorphisms and ischemic cerebrovascular disease in Chinese Han population.
24474498 2014 VKORC1 and CYP2C9 genotypes are predictors of warfarin-related outcomes in children.
24425227 2014 The VKORC1 Asp36Tyr variant and VKORC1 haplotype diversity in Ashkenazi and Ethiopian populations.
24406068 2014 Membrane topology for human vitamin K epoxide reductase.
24399734 2013 Effect of CYP2C9 and VKORC1 genetic variations on warfarin dose requirements in Indian patients.
24288433 2013 Association of functional VKORC1 promoter polymorphism with occurrence and clinical aspects of ischemic stroke in a Greek population.
24287886 2014 Comparative genetics of warfarin resistance.
24198402 2014 Human herpesvirus 8 interleukin-6 contributes to primary effusion lymphoma cell viability via suppression of proapoptotic cathepsin D, a cointeraction partner of vitamin K epoxide reductase complex subunit 1 variant 2.
24029542 2013 Warfarin pharmacogenetics: a controlled dose-response study in healthy subjects.
23982176 2013 Human VKORC1 mutations cause variable degrees of 4-hydroxycoumarin resistance and affect putative warfarin binding interfaces.
23972066 2013 Role of the vitamin K epoxide reductase complex subunit 1 (VKORC1) -1639G>A gene polymorphism in patients with retinal vein occlusion.
23932037 2013 Influence of CYP2C9 and VKORC1 genotypes on the risk of hemorrhagic complications in warfarin-treated patients: a systematic review and meta-analysis.
23928870 2014 Nutri-pharmacogenomics of warfarin anticoagulation therapy: VKORC1 genotype-dependent influence of dietary vitamin K intake.
23928358 2013 VKORC1L1, an enzyme rescuing the vitamin K 2,3-epoxide reductase activity in some extrahepatic tissues during anticoagulation therapy.
23918929 2013 The vitamin K oxidoreductase is a multimer that efficiently reduces vitamin K epoxide to hydroquinone to allow vitamin K-dependent protein carboxylation.
23800980 2014 Factors affecting warfarin dose requirements and quality of anticoagulation in adult Egyptian patients: role of gene polymorphism.
23774101 2013 The bleeding risk during warfarin therapy is associated with the number of variant alleles of CYP2C9 and VKORC1 genes.
23771743 2014 Influence of VKORC1 gene polymorphisms on the effect of oral vitamin K supplementation in over-anticoagulated patients.
23732872 2013 Association of VKORC1-1639G>A polymorphism with susceptibility to ossification of the posterior longitudinal ligament of the spine: a Korean study.
23726967 2013 Resequencing of VKORC1, CYP2C9 and CYP4F2 genes in Italian patients requiring extreme low and high warfarin doses.
23710884 2013 Evaluation of warfarin resistance using transcription activator-like effector nucleases-mediated vitamin K epoxide reductase knockout HEK293 cells.
23703341 2013 Relationship between VKORC1 single nucleotide polymorphism 1173C>T, bone mineral density & carotid intima-media thickness.
23691226 2013 Novel associations of VKORC1 variants with higher acenocoumarol requirements.
23677510 2014 The effect of CYP2C9, VKORC1 and CYP4F2 polymorphism and of clinical factors on warfarin dosage during initiation and long-term treatment after heart valve surgery.
23586031 2013 Genotyping of CYP2C9 and VKORC1 in the Arabic population of Al-Ahsa, Saudi Arabia.
23571513 2013 VKORC1 Asp36Tyr geographic distribution and its impact on warfarin dose requirements in Egyptians.
23563037 2013 Variability in CYP2C9 allele frequency: a pilot study of its predicted impact on warfarin response among healthy South and North Indians.
23481074 2013 Cytochrome P450 (CYP2C9*2,*3) & vitamin-K epoxide reductase complex (VKORC1 -1639G<A) gene polymorphisms & their effect on acenocoumarol dose in patients with mechanical heart valve replacement.
23473641 2013 Effect of CYP2C9 and VKORC1 genetic polymorphisms on mean daily maintenance dose of acenocoumarol in South Indian patients.
23452238 2013 A new cell culture-based assay quantifies vitamin K 2,3-epoxide reductase complex subunit 1 function and reveals warfarin resistance phenotypes not shown by the dithiothreitol-driven VKOR assay.
23362849 2014 VKORC1 C1173T and VKORC1 G-1639A gene polymorphisms in Turkish Behçet's patients with ocular and non-ocular involvement.
23287317 Association of CYP2C9 polymorphisms with phenytoin toxicity in Indian patients.
23285254 2012 Positive selection in the chromosome 16 VKORC1 genomic region has contributed to the variability of anticoagulant response in humans.
23279643 2013 The VKORC1 and CYP2C9 genotypes are associated with over-anticoagulation during initiation of warfarin therapy in children.
23201087 2013 Effect of different genetics variants: CYP2C9*2, CYP2C9*3 of cytochrome P-450 CYP2C9 and 1639G>A of the VKORC1 gene; On acenocoumarol requirement in Moroccan patients.
23183958 2013 Genetic and clinical determinants influencing warfarin dosing in children with heart disease.
23159639 2013 The impact of the CYP2C9 and VKORC1 polymorphisms on acenocoumarol dose requirements in a Romanian population.
23154637 2013 miR-133a regulates vitamin K 2,3-epoxide reductase complex subunit 1 (VKORC1), a key protein in the vitamin K cycle.
23124848 2013 Brief Report: Single-nucleotide polymorphisms in VKORC1 are risk factors for systemic lupus erythematosus in Asians.
23113310 2012 CYP2C9 and VKORC1 gene polymorphism is inessential for bleeding development under conditions of oral application of anticoagulant acenocoumarol in Russian patients at high risk of thromboembolic complications.
23065265 2012 The prevalence of VKORC1 1639 G>A and CYP2C9*2*3 genotypes in patients that requiring anticoagulant therapy in Turkish population.
23039877 2012 VKORC1 mutations detected in patients resistant to vitamin K antagonists are not all associated with a resistant VKOR activity.
23018470 2012 Inter-individual differences in baseline coagulation activities and their implications for international normalized ratio control during warfarin initiation therapy.
22952875 2012 Influence of CYP2C9 and VKORC1 on patient response to warfarin: a systematic review and meta-analysis.
22923610 2012 Human vitamin K epoxide reductase and its bacterial homologue have different membrane topologies and reaction mechanisms.
22915323 2013 VKORC1 rs2359612C allele is associated with increased risk of coronary artery disease in the presence of coronary calcification.
22871975 2012 Effect of the VKORC1 D36Y variant on warfarin dose requirement and pharmacogenetic dose prediction.
22864379 2013 VKORC1-dependent pharmacokinetics of intravenous and oral phylloquinone (vitamin K1) mixed micelles formulation.
22855348 2013 Responsiveness to low-dose warfarin associated with genetic variants of VKORC1, CYP2C9, CYP2C19, and CYP4F2 in an Indonesian population.
22854539 2012 Warfarin pharmacogenetics: development of a dosing algorithm for Omani patients.
22808915 2012 CYP2C9 and VKORC1 polymorphisms are differently distributed in the Brazilian population according to self-declared ethnicity or genetic ancestry.
22592842 2012 Oral anticoagulation and VKORC1 polymorphism in patients with a mechanical heart prosthesis: a 6-year follow-up.
22571356 2012 Polymorphisms in VKORC1 have more impact than CYP2C9 polymorphisms on early warfarin International Normalized Ratio control and bleeding rates.
22534826 2012 A new algorithm to predict warfarin dose from polymorphisms of CYP4F2 , CYP2C9 and VKORC1 and clinical variables: derivation in Han Chinese patients with non valvular atrial fibrillation.
22533669 2012 Frequency of VKORC1 (C1173T) and CYP2C9 genetic polymorphisms in Egyptians and their influence on warfarin maintenance dose: proposal for a new dosing regimen.
22528326 2012 Impact of CYP2C9*3, VKORC1-1639, CYP4F2rs2108622 genetic polymorphism and clinical factors on warfarin maintenance dose in Han-Chinese patients.
22496424 2012 Vitamin K epoxide reductase contributes to protein disulfide formation and redox homeostasis within the endoplasmic reticulum.
22452429 2012 Warfarin pharmacogenetics: polymorphisms of the CYP2C9, CYP4F2, and VKORC1 loci in a genetically admixed Omani population.
22409277 2012 An evaluation of gene-gene interaction between the CYP2C9 and VKORC1 genotypes affecting the anticoagulant effect of phenprocoumon and acenocoumarol.
22394334 Predictive value of the vitamin K epoxide reductase complex subunit 1 G-1639A and C1173T single nucleotide polymorphisms in retinal vein occlusion.
22393834 2012 Genetic polymorphisms of VKORC1, CYP2C9, CYP4F2 in Bai, Tibetan Chinese.
22349464 2012 A new warfarin dosing algorithm including VKORC1 3730 G > A polymorphism: comparison with results obtained by other published algorithms.
22290467 2012 Prevalence of CYP2C9 and VKORC1 alleles in the Argentine population and implications for prescribing dosages of anticoagulants.
22252093 2012 Long-term anticoagulant effects of the CYP2C9 and VKORC1 genotypes in acenocoumarol users.
22198820 2012 Integrating interacting drugs and genetic variations to improve the predictability of warfarin maintenance dose in Chinese patients.
22188360 2012 Copy number variation and warfarin dosing: evaluation of CYP2C9, VKORC1, CYP4F2, GGCX and CALU.
22173503 2011 Decreased expression of vitamin K epoxide reductase complex subunit 1 in kidney of patients with calcium oxalate urolithiasis.
22130800 2012 Vitamin K antagonists in children with heart disease: height and VKORC1 genotype are the main determinants of the warfarin dose requirement.
22130532 2012 Human herpesvirus 8 viral interleukin-6 interacts with splice variant 2 of vitamin K epoxide reductase complex subunit 1.
22075505 2011 The effect of CYP2C9, VKORC1 genotypes and old age on warfarin pharmacologic sensitivity in korean patients with thromboembolic disease.
22023024 2012 The pharmacogenetics of the response to warfarin in Chinese.
22010099 2012 VKORC1 and CYP2C9 genotype and patient characteristics explain a large proportion of the variability in warfarin dose requirement among children.
21939388 2012 Mycobacterium tuberculosis vitamin K epoxide reductase homologue supports vitamin K-dependent carboxylation in mammalian cells.
21883387 2012 Impact of genetic factors (VKORC1, CYP2C9, CYP4F2 and EPHX1) on the anticoagulation response to fluindione.
21800014 2011 Haplotypes of VKORC1, NQO1 and GGCX, their effect on activity levels of vitamin K-dependent coagulation factors, and the risk of venous thrombosis.
21767890 2011 Association of VKORC1 -1639 G>A polymorphism with carotid intima-media thickness in type 2 diabetes mellitus.
21766908 2011 Development of cocaine-induced interstitial lung damage in two CYP2C and VKORC1 variant allele carriers.
21725053 2011 Prospective evaluation of a pharmacogenetics-guided warfarin loading and maintenance dose regimen for initiation of therapy.
21651319 2011 Pharmacogenetics of coumarin dosing: prevalence of CYP2C9 and VKORC1 polymorphisms in the Lebanese population.
21639946 2011 Genetic factors associated with patient-specific warfarin dose in ethnic Indonesians.
21638223 2011 Extreme sensitivity to acenocoumarol therapy in patient with both VKORC.-1639 A/A and CYP2C9*1/*3 genotypes.
21562135 2011 Absence of novel CYP4F2 and VKORC1 coding region DNA variants in patients requiring high warfarin doses.
21544933 2011 [CYP2C9 and VKORC1 gene polymorphism and acenocoumarol anticoagulant activity in Russian patients at high risk of thromboembolic complications].
21362126 2011 More on: endoplasmic reticulum loop VKORC1 substitutions cause warfarin resistance but do not diminish gamma-carboxylation of the vitamin K-dependent coagulation factors.
21248432 2010 Frequencies of VKORC1 -1639 G>A, CYP2C9*2 and CYP2C9*3 genetic variants in the Northern Indian population.
21215088 2010 [Gene polymorphism of CYP450 2C9 and VKORC1 in Chinese population and their relationships to the maintaining dosage of warfarin].
21179439 2010 VKORC1 common variation and bone mineral density in the Third National Health and Nutrition Examination Survey.
21179214 2010 VKORC1 pharmacogenetics and pharmacoproteomics in patients on warfarin anticoagulant therapy: transthyretin precursor as a potential biomarker.
21176721 2011 Contribution of 1173C > T polymorphism in the VKORC1 gene to warfarin dose requirements in Han Chinese patients receiving anticoagulation.
21148049 2011 Influence of CYP2C9 and VKORC1 polymorphisms on warfarin and acenocoumarol in a sample of Lebanese people.
21127708 2011 Genetic variation of VKORC1 and CYP4F2 genes related to warfarin maintenance dose in patients with myocardial infarction.
21110192 2011 Contribution of VKORC1 and CYP2C9 polymorphisms in the interethnic variability of warfarin dose in Malaysian populations.
21103663 2011 Identification of VKORC1 interaction partners by split-ubiquitin system and coimmunoprecipitation.
21063236 2011 Dependency of phenprocoumon dosage on polymorphisms in the VKORC1, CYP2C9, and CYP4F2 genes.
21057703 2011 Impact of pharmacokinetic (CYP2C9) and pharmacodynamic (VKORC1, F7, GGCX, CALU, EPHX1) gene variants on the initiation and maintenance phases of phenprocoumon therapy.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20978134 2011 Novel insight into the mechanism of the vitamin K oxidoreductase (VKOR): electron relay through Cys43 and Cys51 reduces VKOR to allow vitamin K reduction and facilitation of vitamin K-dependent protein carboxylation.
20946155 2011 Thirteen novel VKORC1 mutations associated with oral anticoagulant resistance: insights into improved patient diagnosis and treatment.
20930419 2010 Pharmacokinetic and pharmacodynamic variation associated with VKORC1 and CYP2C9 polymorphisms in Thai patients taking warfarin.
20885015 Investigation of allele and genotype frequencies of CYP2C9, CYP2C19 and VKORC1 in Iran.
20860466 2010 VKORC1 polymorphisms in Brazilians: comparison with the Portuguese and Portuguese-speaking Africans and pharmacogenetic implications.
20854800 2011 Genotyping three SNPs affecting warfarin drug response by isothermal real-time HDA assays.
20842355 2010 VKORC1-1639G>A, CYP2C9, EPHX1691A>G genotype, body weight, and age are important predictors for warfarin maintenance doses in patients with mechanical heart valve prostheses in southwest China.
20833980 2010 In pediatric patients, age has more impact on dosing of vitamin K antagonists than VKORC1 or CYP2C9 genotypes.
20833655 2010 Genome-wide association study identifies genetic determinants of warfarin responsiveness for Japanese.
20831047 2010 [Anticoagulant action and safety of warfarin dosing based on pharmacogenetic testing: results of the first Russian prospective pilot study].
20811787 2010 The association of protein S Tokushima-K196E with a risk of deep vein thrombosis.
20733952 2010 Warfarin genotyping using three different platforms.
20716240 2010 New genetic variant that might improve warfarin dose prediction in African Americans.
20709439 2010 Warfarin dosing in patients with impaired kidney function.
20696932 2010 Vitamin K epoxide reductase prefers ER membrane-anchored thioredoxin-like redox partners.
20653676 2010 CYP4F2 rs2108622: a minor significant genetic factor of warfarin dose in Han Chinese patients with mechanical heart valve replacement.
20653674 2010 A haplotype of CYP2C9 associated with warfarin sensitivity in mechanical heart valve replacement patients.
20637959 2010 The impact of genetic polymorphisms and patient characteristics on warfarin dose requirements: a cross-sectional study in Iran.
20621035 2010 Vitamin K epoxide reductase (VKORC1) gene mutations in osteoporosis: A pilot study.
20615525 2010 VKORC1 V66M mutation in African Brazilian patients resistant to oral anticoagulant therapy.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20597268 2010 [Recurrent thromboses and hemorrhagic complications in patients with antiphospholipid syndrome during therapy with warfarin plus aspirin].
20585834 2011 Warfarin dosing algorithm using clinical, demographic and pharmacogenetic data from Chinese patients.
20585445 2010 A novel, single algorithm approach to predict acenocoumarol dose based on CYP2C9 and VKORC1 allele variants.
20581661 2010 The c.-1639G>A polymorphism of the VKORC1 gene in Serbian population: retrospective study of the variability in response to oral anticoagulant therapy.
20579077 2011 Novel VKORC1 mutations associated with warfarin sensitivity.
20575749 2010 VKORC1 haplotypes influence the performance characteristics of PIVKAII for screening of hepatocellular carcinoma.
20569971 2010 Algorithms using clinical and genetic data (CYP2C9, VKORC1) are relevant to predict warfarin dose in patients with different INR targets.
20555338 2010 Worldwide allele frequency distribution of four polymorphisms associated with warfarin dose requirements.
20553802 2010 Application of Akaike information criterion to evaluate warfarin dosing algorithm.
20532885 2010 Study of 18 functional hemostatic polymorphisms in mucocutaneous bleeding disorders.
20504253 2010 Combined CYP2C9, VKORC1 and CYP4F2 frequencies among racial and ethnic groups.
20499136 2010 An evaluation of nine genetic variants related to metabolism and mechanism of action of warfarin as applied to stable dose prediction.
20488169 2010 CYP2C9 and VKORC1 genotypes in Puerto Ricans: A case for admixture-matching in clinical pharmacogenetic studies.
20459419 2010 [Which of algorithms of warfarin dosing based on results of pharmacogenetic testing is suitable for patients in Russia].
20442691 2010 Extending and evaluating a warfarin dosing algorithm that includes CYP4F2 and pooled rare variants of CYP2C9.
20434758 2010 VKORC1 and CYP2C9 genetic polymorphisms in hepatic or portal vein thrombosis.
20421126 2010 A regression model to predict warfarin dose from clinical variables and polymorphisms in CYP2C9, CYP4F2, and VKORC1: Derivation in a sample with predominantly a history of venous thromboembolism.
20386359 2010 Gene-based warfarin dosing compared with standard of care practices in an orthopedic surgery population: a prospective, parallel cohort study.
20381283 2010 Warfarin genotyping reduces hospitalization rates results from the MM-WES (Medco-Mayo Warfarin Effectiveness study).
20376629 2010 VKORC1 -1639G>A and CYP2C9*3 are the major genetic predictors of phenprocoumon dose requirement.
20359285 2010 Comparison of enzyme kinetic parameters obtained in vitro for reactions mediated by human CYP2C enzymes including major CYP2C9 variants.
20354686 2010 Increased frequency of CYP2C9 variant alleles and homozygous VKORC1*2B carriers in warfarin-treated patients with excessive INR response.
20339978 2010 The impact of CYP2C9 and VKORC1 genetic polymorphism and patient characteristics upon warfarin dose requirements in an adult Turkish population.
20339191 2010 Evaluation of pharmacogenetic algorithm for warfarin dose requirements in Japanese patients.
20228265 2010 Validation and comparison of pharmacogenetics-based warfarin dosing algorithms for application of pharmacogenetic testing.
20226775 2010 Comparison of assay systems for warfarin-related CYP2C9 and VKORC1 genotyping.
20210733 2010 Distribution of CYP2C9 and VKORC1 risk alleles for warfarin sensitivity and resistance in the Israeli population.
20204461 2010 Accuracy assessment of pharmacogenetically predictive warfarin dosing algorithms in patients of an academic medical center anticoagulation clinic.
20203262 2010 Warfarin pharmacogenetics: a single VKORC1 polymorphism is predictive of dose across 3 racial groups.
20193673 2010 Genotype polymorphisms of GGCX, NQO1, and VKORC1 genes associated with risk susceptibility in patients with large-artery atherosclerotic stroke.
20163834 2010 The VKORC1 promoter is occupied by c-Myc transcription factor in HepG2 cells.
20149073 2010 Pharmacogenetics of acenocoumarol in patients with extreme dose requirements.
20121287 2010 Variant VKORC1 and CYP2C9 alleles in patients with diffuse alveolar hemorrhage caused by oral anticoagulants.
20075209 2010 Rapid genotyping of single nucleotide polymorphisms influencing warfarin drug response by surface-enhanced laser desorption and ionization time-of-flight (SELDI-TOF) mass spectrometry.
20073138 2009 Prevalence of combinatorial CYP2C9 and VKORC1 genotypes in Puerto Ricans: implications for warfarin management in Hispanics.
20072124 2010 Genetic and clinical predictors of warfarin dose requirements in African Americans.
20043560 2009 Prevalence of CYP2C9 and VKORC1 mutation in patients with valvular heart disease in northern Thailand.
20020283 2010 Genetic determinants of acenocoumarol and phenprocoumon maintenance dose requirements.
19958090 2009 Genetic determinants of warfarin dosing in the Han-Chinese population.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19942260 2010 Impact of VKORC1 gene polymorphism on interindividual and interethnic warfarin dosage requirement--a systematic review and meta analysis.
19941044 2010 Ethnic differences in the population pharmacokinetics and pharmacodynamics of warfarin.
19875892 2009 A vitamin K epoxide reductase-oxidase complex gene polymorphism (-1639G>A) and interindividual variability in the dose-effect of vitamin K antagonists.
19874474 2010 Ability of VKORC1 and CYP2C9 to predict therapeutic warfarin dose during the initial weeks of therapy.
19842934 2009 VKORC1 haplotypes in five East-Asian populations and Indians.
19794411 2010 Genetic factors (VKORC1, CYP2C9, EPHX1, and CYP4F2) are predictor variables for warfarin response in very elderly, frail inpatients.
19781295 2009 VKORC1 genotypes are associated with response to warfarin but free warfarin concentration during initial anticoagulation in healthy Chinese volunteers.
19780415 2009 [The c.-1639g > A polymorphism of the VKORC1 gene and his influence on the therapeutic response during oral anticoagulants use].
19745563 2009 VKORC1 diplotype-derived dosing model to explain variability in warfarin dose requirements in Asian patients.
19738376 2009 Pharmacogenetic testing for guiding de novo phenprocoumon therapy in stroke patients.
19663669 2009 CYP2C9*8 is prevalent among African-Americans: implications for pharmacogenetic dosing.
19652895 2009 Polymorphisms in VKORC1 and GGCX are not major genetic determinants of vitamin K-dependent coagulation factor activity in Western Germans.
19578179 2009 A genome-wide association study of acenocoumarol maintenance dosage.
19567378 2010 Pharmacogenetic impact of VKORC1 and CYP2C9 allelic variants on warfarin dose requirements in a hispanic population isolate.
19545555 2009 Comparison of performance of three commercial platforms for warfarin sensitivity genotyping.
19538716 2009 Thrombotic genetic risk factors and warfarin pharmacogenetic variants in São Miguel's healthy population (Azores).
19530970 2009 Vitamin K epoxide reductase complex 1 (VKORC1) haplotypes in healthy Hungarian and Roma population samples.
19436136 2009 Association of sequence variations in vitamin K epoxide reductase and gamma-glutamyl carboxylase genes with biochemical measures of vitamin K status.
19387626 2009 Exploring warfarin pharmacogenomics with the extreme-discordant-phenotype methodology: impact of FVII polymorphisms on stable anticoagulation with warfarin.
19376320 2009 Vitamin K epoxide reductase complex subunit 1 gene polymorphism is associated with atherothrombotic complication after drug-eluting stent implantation: 2-Center prospective cohort study.
19324988 2009 Validation of clinical testing for warfarin sensitivity: comparison of CYP2C9-VKORC1 genotyping assays and warfarin-dosing algorithms.
19320825 2009 VKORC1 genetic polymorphism and risk of venous thromboembolism in postmenopausal women: new findings and meta-analysis.
19319511 2009 Pharmacogenetic characteristics of patients with complicated phenprocoumon dosing.
19300499 2009 A genome-wide association study confirms VKORC1, CYP2C9, and CYP4F2 as principal genetic determinants of warfarin dose.
19297219 Influence of CYP2C9 and VKORC1 on warfarin response during initiation of therapy.
19233910 2009 A multiplex assay for detecting genetic variations in CYP2C9, VKORC1, and GGCX involved in warfarin metabolism.
19225451 2009 Genotypes associated with reduced activity of VKORC1 and CYP2C9 and their modification of acenocoumarol anticoagulation during the initial treatment period.
19207028 2009 CYP4F2 genetic variant (rs2108622) significantly contributes to warfarin dosing variability in the Italian population.
19181737 2009 Rapid single-nucleotide polymorphism detection of cytochrome P450 (CYP2C9) and vitamin K epoxide reductase (VKORC1) genes for the warfarin dose adjustment by the SMart-amplification process version 2.
19177029 2009 Validation of VKORC1 and CYP2C9 genotypes on interindividual warfarin maintenance dose: a prospective study in Chinese patients.
19172700 2008 A genotyping method for VKORC1 1173C > T by Pyrosequencing technology.
19139476 2009 Pharmacogenomics of warfarin: uncovering a piece of the warfarin mystery.
19135231 2009 Effect of VKORC1-1639 G>A polymorphism, body weight, age, and serum albumin alterations on warfarin response in Japanese patients.
19124480 2009 Serum undercarboxylated osteocalcin as biomarker of vitamin K intake and risk of prostate cancer: a nested case-control study in the Heidelberg cohort of the European prospective investigation into cancer and nutrition.
19117406 2009 SYBR Green-based real-time PCR assay for detection of VKORC1 and CYP2C9 polymorphisms that modulate warfarin dose requirement.
19099951 2008 [Association between CYP2C9 and VKORC1 genetic polymorphism and warfarin dose requirements].
19077919 2009 Effect of CYP2C9 and VKORC1 genotypes on early-phase and steady-state warfarin dosing in Korean patients with mechanical heart valve replacement.
19074728 2009 Relative contribution of CYP2C9 and VKORC1 genotypes and early INR response to the prediction of warfarin sensitivity during initiation of therapy.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19034590 2009 VKORC1 variant genotypes influence warfarin response in patients undergoing total joint arthroplasty: a pilot study.
19025725 2009 The association between dietary vitamin K intake and serum undercarboxylated osteocalcin is modulated by vitamin K epoxide reductase genotype.
19018719 2008 VKORC1 and CYP2C9 allelic variants influence acenocoumarol dose requirements in Greek patients.
19018718 2008 VKORC1 polymorphisms in Amerindian populations of Brazil.
18950464 2008 The influence of polymorphisms of VKORC1 and CYP2C9 on major gastrointestinal bleeding risk in anticoagulated patients.
18855533 2008 VKORC1 polymorphisms, haplotypes and haplotype groups on warfarin dose among African-Americans and European-Americans.
18848323 2009 Prothrombotic genetic variants and atherosclerosis in patients with cerebral ischemia of arterial origin.
18841283 2008 Single nucleotide polymorphisms in the VKORC1 gene and the risk of stroke in the Southern German population.
18826394 2008 Lack of association between variants in the VKORC1 gene and cerebrovascular or coronary heart disease.
18813101 2008 Impact of VKORC1 haplotypes on long-term graft function in kidney transplantation.
18805772 2008 [Haplogroup analysis of vitamin-K epoxide reductase (VKORC1) gene: novel element in the optimization of anticoagulant therapy].
18781852 2008 Effects of CYP2C9 and VKORC1 on INR variations and dose requirements during initial phase of anticoagulant therapy.
18754001 2008 Pharmacogenetics of warfarin: development of a dosing algorithm for brazilian patients.
18698879 2008 Pharmacogenetics of oral anticoagulants: a basis for dose individualization.
18690342 2008 An analysis of the relative effects of VKORC1 and CYP2C9 variants on anticoagulation related outcomes in warfarin-treated patients.
18680736 2008 Genetic factors contribute to patient-specific warfarin dose for Han Chinese.
18680536 2008 Pharmacodynamic resistance to warfarin is associated with nucleotide substitutions in VKORC1.
18629445 2009 Dependency of phenprocoumon dosage on polymorphisms in the VKORC1 and CYP2C9 genes.
18574025 2009 The largest prospective warfarin-treated cohort supports genetic forecasting.
18559094 2008 Warfarin dose and INR related to genotypes of CYP2C9 and VKORC1 in patients with myocardial infarction.
18542936 2008 VKORC1 and CYP2C9 polymorphisms are associated with warfarin dose requirements in Turkish patients.
18535201 2008 A genome-wide scan for common genetic variants with a large influence on warfarin maintenance dose.
18532998 2008 Multiple genetic alterations in vitamin K epoxide reductase complex subunit 1 gene (VKORC1) can explain the high dose requirement during oral anticoagulation in humans.
18523153 2008 Regulatory polymorphism in vitamin K epoxide reductase complex subunit 1 (VKORC1) affects gene expression and warfarin dose requirement.
18516070 2008 Pharmacodynamic interaction of warfarin with cranberry but not with garlic in healthy subjects.
18480003 2008 Performance of commercial platforms for rapid genotyping of polymorphisms affecting warfarin dose.
18466315 2008 Vitamin K epoxide reductase complex subunit 1 (VKORC1 ) polymorphism influences the anticoagulation response subsequent to vitamin K intake: a pilot study.
18466099 2008 Influence of CYP2C9 and VKORC1 on warfarin dose, anticoagulation attainment and maintenance among European-Americans and African-Americans.
18449434 2008 No clear link between VKORC1 genetic polymorphism and the risk of venous thrombosis or peripheral arterial disease.
18370846 2008 Dosing algorithm for warfarin using CYP2C9 and VKORC1 genotyping from a multi-ethnic population: comparison with other equations.
18322281 2008 Genetic determinants of response to warfarin during initial anticoagulation.
18305455 2008 Use of pharmacogenetic and clinical factors to predict the therapeutic dose of warfarin.
18281915 2008 A rapid-ACCE review of CYP2C9 and VKORC1 alleles testing to inform warfarin dosing in adults at elevated risk for thrombotic events to avoid serious bleeding.
18252229 2008 Warfarin pharmacogenetics: CYP2C9 and VKORC1 genotypes predict different sensitivity and resistance frequencies in the Ashkenazi and Sephardi Jewish populations.
18240904 2007 Ethnic differences in the VKORC1 gene polymorphism and an association with warfarin dosage requirements in cardiovascular surgery patients.
18218987 2008 Vitamin K epoxide reductase complex subunit 1 (VKORC1) polymorphism and aortic calcification: the Rotterdam Study.
18183038 2008 Prospective study of warfarin dosage requirements based on CYP2C9 and VKORC1 genotypes.
18034619 2007 Allelic variants in the CYP2C9 and VKORC1 loci and interindividual variability in the anticoagulant dose effect of warfarin in Italians.
18034618 2007 Factors influencing warfarin dose requirements in African-Americans.
18030307 2008 Combination of phenotype assessments and CYP2C9-VKORC1 polymorphisms in the determination of warfarin dose requirements in heavily medicated patients.
17995970 2008 Influence of APOE genotypes and VKORC1 haplotypes on warfarin dose requirements in Asian patients.
17989110 2007 Randomized trial of genotype-guided versus standard warfarin dosing in patients initiating oral anticoagulation.
17961434 2007 [Vitamin K epoxide reductase complex 1 gene polymorphism and warfarin dose requirement in Chinese patients].
17899045 2007 Contribution of age, body weight, and CYP2C9 and VKORC1 genotype to the anticoagulant response to warfarin: proposal for a new dosing regimen in Chinese patients.
17883699 2007 Common VKORC1 variants are not associated with arterial or venous thrombosis.
17883698 2007 Vitamin K epoxide reductase genetic polymorphism is associated with venous thromboembolism: results from the EDITH Study.
17849045 2007 Current pharmacogenetic developments in oral anticoagulation therapy: the influence of variant VKORC1 and CYP2C9 alleles.
17764537 2007 Gamma-glutamyl carboxylase (GGCX) tagSNPs have limited utility for predicting warfarin maintenance dose.
17721328 2007 CYP2C9 and VKORC1 genetic polymorphism analysis might be necessary in patients with Factor V Leiden and prothrombin gene G2021A mutation(s).
17666014 2007 VKORC1 gene variation and venous thrombosis: 'another one bites the dust'?
17653141 2008 Influence of CYP2C9 and VKORC1 1173C/T genotype on the risk of hemorrhagic complications in African-American and European-American patients on warfarin.
17596133 2007 The genetic interaction between VKORC1 c1173t and calumenin a29809g modulates the anticoagulant response of acenocoumarol.
17549303 2007 Functional promoter polymorphism in the VKORC1 gene is no major genetic determinant for coronary heart disease in Northern Germans.
17510308 2007 Estimation of warfarin maintenance dose based on VKORC1 (-1639 G>A) and CYP2C9 genotypes.
17413769 2007 Plasma S/R ratio of warfarin co-varies with VKORC1 haplotype.
17391071 2007 Factors affecting the interindividual variability of warfarin dose requirement in adult Korean patients.
17329985 2007 Warfarin response and vitamin K epoxide reductase complex 1 in African Americans and Caucasians.
17325732 2008 Apolipoprotein E genotype and warfarin dosing among Caucasians and African Americans.
17301738 2007 A PK-PD model for predicting the impact of age, CYP2C9, and VKORC1 genotype on individualization of warfarin therapy.
17192772 2007 VKORC1 and CYP2C9 genotypes and phenprocoumon anticoagulation status: interaction between both genotypes affects dose requirement.
17189218 2006 Polymorphisms in vitamin K-dependent gamma-carboxylation-related genes influence interindividual variability in plasma protein C and protein S activities in the general population.
17164330 2006 Purified vitamin K epoxide reductase alone is sufficient for conversion of vitamin K epoxide to vitamin K and vitamin K to vitamin KH2.
17111199 2006 Genotypes of the cytochrome p450 isoform, CYP2C9, and the vitamin K epoxide reductase complex subunit 1 conjointly determine stable warfarin dose: a prospective study.
17110455 2007 A coding VKORC1 Asp36Tyr polymorphism predisposes to warfarin resistance.
17049586 2007 Genotypes of vitamin K epoxide reductase, gamma-glutamyl carboxylase, and cytochrome P450 2C9 as determinants of daily warfarin dose in Japanese patients.
17048007 2007 Association of warfarin dose with genes involved in its action and metabolism.
17031720 1173C>T polymorphism in VKORC1 modulates the required warfarin dose.
17015052 2006 A warfarin-dosing model in Asians that uses single-nucleotide polymorphisms in vitamin K epoxide reductase complex and cytochrome P450 2C9.
16890578 2006 VKORC1 gene variations are the major contributors of variation in warfarin dose in Japanese patients.
16879214 2006 Main haplotypes and mutational analysis of vitamin K epoxide reductase (VKORC1) in a Swedish population: a retrospective analysis of case records.
16847429 2006 APOE genotype makes a small contribution to warfarin dose requirements.
16815313 2006 VKORC1 and CYP2C9 genotypes and acenocoumarol anticoagulation status: interaction between both genotypes affects overanticoagulation.
16700826 2006 Genetic polymorphism of vitamin K epoxide reductase (VKORC1) 1173C>T in a Chinese and a Caucasian population.
16677080 Vitamin K epoxide reductase complex subunit 1 (VKORC1): the key protein of the vitamin K cycle.
16676068 2006 The influence of sequence variations in factor VII, gamma-glutamyl carboxylase and vitamin K epoxide reductase complex genes on warfarin dose requirement.
16634640 2006 r-VKORC1 expression in factor IX BHK cells increases the extent of factor IX carboxylation but is limited by saturation of another carboxylation component or by a shift in the rate-limiting step.
16611750 2006 Polymorphisms in the VKORC1 gene are strongly associated with warfarin dosage requirements in patients receiving anticoagulation.
16611310 2006 The c.-1639G > A polymorphism of the VKORC1 gene is a major determinant of the response to acenocoumarol in anticoagulated patients.
16580898 2006 Influence of coagulation factor, vitamin K epoxide reductase complex subunit 1, and cytochrome P450 2C9 gene polymorphisms on warfarin dose requirements.
16549638 2006 VKORC1 haplotypes are associated with arterial vascular diseases (stroke, coronary heart disease, and aortic dissection).
16513444 2006 Interethnic variability of warfarin maintenance requirement is explained by VKORC1 genotype in an Asian population.
16432637 2006 Association of VKORC1 and CYP2C9 polymorphisms with warfarin dose requirements in Japanese patients.
16424822 2006 Different contributions of polymorphisms in VKORC1 and CYP2C9 to intra- and inter-population differences in maintenance dose of warfarin in Japanese, Caucasians and African-Americans.
16420583 2006 Population variation in VKORC1 haplotype structure.
16270630 2005 Site-directed mutagenesis of coumarin-type anticoagulant-sensitive VKORC1: evidence that highly conserved amino acids define structural requirements for enzymatic activity and inhibition by warfarin.
16270629 2005 VKORC1 haplotypes and their impact on the inter-individual and inter-ethnical variability of oral anticoagulation.
16201835 2005 A C1173T dimorphism in the VKORC1 gene determines coumarin sensitivity and bleeding risk.
16141794 2005 Association of Vitamin K epoxide reductase complex 1 (VKORC1) variants with warfarin dose in a Hong Kong Chinese patient population.
16030016 2005 Increased production of functional recombinant human clotting factor IX by baby hamster kidney cells engineered to overexpress VKORC1, the vitamin K 2,3-epoxide-reducing enzyme of the vitamin K cycle.
15978113 2005 A vitamin K epoxide reductase complex subunit-1 (VKORC1) mutation in a patient with vitamin K antagonist resistance.
15972850 2005 Vitamin k epoxide reductase: a protein involved in angiogenesis.
15947090 2005 The impact of CYP2C9 and VKORC1 genetic polymorphism and patient characteristics upon warfarin dose requirements: proposal for a new dosing regimen.
15930419 2005 Effect of VKORC1 haplotypes on transcriptional regulation and warfarin dose.
15888487 2005 A novel functional VKORC1 promoter polymorphism is associated with inter-individual and inter-ethnic differences in warfarin sensitivity.
15883587 2005 Common VKORC1 and GGCX polymorphisms associated with warfarin dose.
15879509 2005 The genetic basis of resistance to anticoagulants in rodents.
15790782 2005 Cytochrome P450 2C9 (CYP2C9) and vitamin K epoxide reductase (VKORC1) genotypes as determinants of acenocoumarol sensitivity.
15716279 2005 Membrane topology mapping of vitamin K epoxide reductase by in vitro translation/cotranslocation.
15630486 2005 Pharmacodynamic resistance to warfarin associated with a Val66Met substitution in vitamin K epoxide reductase complex subunit 1.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358623 2005 A polymorphism in the VKORC1 gene is associated with an interindividual variability in the dose-anticoagulant effect of warfarin.
15276181 2004 Vitamin K epoxide reductase: homology, active site and catalytic mechanism.
14765195 2004 Identification of the gene for vitamin K epoxide reductase.
14765194 2004 Mutations in VKORC1 cause warfarin resistance and multiple coagulation factor deficiency type 2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384421 2002 Homozygosity mapping of a second gene locus for hereditary combined deficiency of vitamin K-dependent clotting factors to the centromeric region of chromosome 16.
11154138 2000 Congenital deficiency of vitamin K dependent coagulation factors in two families presents as a genetic defect of the vitamin K-epoxide-reductase-complex.