Property Summary

NCBI Gene PubMed Count 24
PubMed Score 11.17
PubTator Score 9.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.400 2.2e-04
osteosarcoma 3.167 9.5e-08
astrocytoma 1.600 3.9e-03
glioblastoma 1.300 3.9e-03
pancreatic ductal adenocarcinoma liver m... 1.570 1.5e-02
intraductal papillary-mucinous carcinoma... 1.100 5.0e-03
intraductal papillary-mucinous neoplasm ... 1.500 7.8e-03
lung cancer 2.400 3.4e-06
subependymal giant cell astrocytoma 1.318 2.3e-02
lung adenocarcinoma 1.100 2.1e-12
Alzheimer's disease 1.100 2.4e-02
Pick disease 1.700 5.6e-07
ovarian cancer 2.400 1.7e-07
pituitary cancer -1.200 1.5e-04

Gene RIF (14)

PMID Text
26460480 VGLL4 - novel candidate genes validated in a large case-control sample of schizophrenia.
25701461 The expression level of VGLL4 protein was down-regulated in gastric cancer tissues.VGLL4 inhibits epithelial-mesenchymal transition in part through suppressing Wnt-beta-catenin signaling pathway in gastric cancer.
25352025 our study suggested that downregulation of VGLL4 was very important in the progression of ESCC, and restoring the function of VGLL4 might be a promising therapeutic strategy for ESCC.
24983835 rs2616551 in VGLL4 was found to be nominally associated with anorexia nervosa.
24525233 Loss of VGLL4 expression is associated with gastric cancer.
24458094 VGLL4 directly competes with YAP in binding to TEADs and executes its growth-inhibitory function through two TDU domains.
23765749 This study introduces a novel gain-of-function approach for studying hESC maintenance and presents VGLL4 as a previously undescribed regulator of this process.
21839727 Vgl-4 may play a role in the apoptotic pathways by regulating translocation of IAPs between different cell compartments.
20702774 IRF2BP2 was identifies as a novel VGLL4 partner.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
15140898 Vgl-4 modulates the activity of TEF-1 factors and counteracts alpha1-adrenergic activation of gene expression in cardiac myocytes
15140898 A transcriptional cofactor of transcriptional enhancer factor-1 (TEF-1) transcription factors. Interacts with TEF-1 factors through 2 TDU (tondu) motifs. Controls gene expression in cardiac myocytes.
15140898 This gene is named Vestigial-like 4, to distinguish it from 3 previously described genes Vgl-1, Vgl-2 and Vgl-3. Contains 2 motifs, found in the Drosophila transcription cofactor Vestigial, that interact with the TEF-1 family of transcription factors.

AA Sequence

METPLDVLSRAASLVHADDEKREAALRGEPRMQTLPVASALSSHRTGPPPISPSKRKFSMEPGDEDLDCD      1 - 70
NDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSL     71 - 140
DASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVE    141 - 210
EHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMV    211 - 280
SHSHSPSVVS                                                                281 - 290
//

Text Mined References (30)

PMID Year Title
26460480 2015 Expression analysis in a rat psychosis model identifies novel candidate genes validated in a large case-control sample of schizophrenia.
25701461 2015 VGLL4 inhibits EMT in part through suppressing Wnt/?-catenin signaling pathway in gastric cancer.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25352025 2015 Downregulation of VGLL4 in the progression of esophageal squamous cell carcinoma.
24983835 2014 Characterization of genetic variation in the VGLL4 gene in anorexia nervosa.
24525233 2014 A peptide mimicking VGLL4 function acts as a YAP antagonist therapy against gastric cancer.
24458094 2014 VGLL4 functions as a new tumor suppressor in lung cancer by negatively regulating the YAP-TEAD transcriptional complex.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
23765749 2013 Brief report: VGLL4 is a novel regulator of survival in human embryonic stem cells.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21839727 2011 A novel inhibitor of apoptosis protein (IAP)-interacting protein, Vestigial-like (Vgl)-4, counteracts apoptosis-inhibitory function of IAPs by nuclear sequestration.
21079607 2011 A genome-wide association study on common SNPs and rare CNVs in anorexia nervosa.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20702774 2010 IRF2BP2 is a skeletal and cardiac muscle-enriched ischemia-inducible activator of VEGFA expression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15140898 2004 Vgl-4, a novel member of the vestigial-like family of transcription cofactors, regulates alpha1-adrenergic activation of gene expression in cardiac myocytes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.