Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.57
PubTator Score 8.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Gene RIF (5)

AA Sequence

MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEE      1 - 70
EEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALS     71 - 140
SQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYP    141 - 210
LTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDIT    211 - 280
KTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY                            281 - 326
//

Text Mined References (17)

PMID Year Title