Property Summary

NCBI Gene PubMed Count 5
PubMed Score 16.01
PubTator Score 4.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.1e-05
Breast cancer 3578 4.3e-05
pancreatic cancer 2398 1.5e-03
interstitial cystitis 2312 4.8e-03
spina bifida 1074 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -2.200 4.3e-05
interstitial cystitis -1.300 4.8e-03
ovarian cancer 1.400 4.1e-05
pancreatic cancer 1.700 1.5e-03
spina bifida -2.275 3.6e-02

Gene RIF (1)

AA Sequence

MEEMKKTAIRLPKGKQKPIKTEWNSRCVLFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLK      1 - 70
NDDSMSPNQWRYSSPWTKPQPEVPVTNRAANCNLHVPGPMAVNQFSPSLARRASVRPGELWHFSSLAGTS     71 - 140
SLEPGYSHPFPARHLVPEPQPDGKREPLLSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSV    141 - 210
HYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGHPHRYLQHL                          211 - 258
//

Text Mined References (5)

PMID Year Title