Property Summary

NCBI Gene PubMed Count 59
PubMed Score 216.31
PubTator Score 115.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.200 5.8e-06
psoriasis -1.100 1.2e-06
glioblastoma 1.400 2.4e-05
fibroadenoma -1.600 1.5e-02
ductal carcinoma in situ -1.200 1.3e-03
invasive ductal carcinoma -1.200 1.3e-02

Protein-protein Interaction (4)

Gene RIF (42)

PMID Text
26422603 VEGFA and VEGFB associated sub-network, kinase insert domain receptor (KDR), fibronectin 1 (FN1), transforming growth factor beta induced (TGFBI) and proliferating cell nuclear antigen (PCNA) found to interact with at least two of the three hub genes.
25977072 plasma VEGF levels before treatment were lower in patients with schizophrenia and that their VEGF levels increased after treatment.
25633991 Frameshift mutations of VEGFB gene is associated with stomach and colorectal cancers.
25435370 fluid shear stress induces the synthesis of Insulin growth factor-2 and vascular endothelial growth factor (VEGF) B and D, which in turn transactivate MMP-12.
25424698 MMP9 may activate VEGF-B via PI3K/Akt signaling pathway.
25001655 High VEGF-B levels might correlate with the presence of hyperlipidemia and target organ damage in type 2 diabetic patients.
24987705 Roles of vascular endothelial growth factor in amyotrophic lateral sclerosis.
24987005 VEGF-B has possible roles in cardiac protection, energy metabolism support, and neuroprotectin [review]
24374930 Our study suggested that VEGF-B was an angiogenesis factor in vitro and that ERK1/2 and p38-related signaling pathways were involved in these VEGF-B activities.
24145997 Low VEGFB and VEGFD gene expression is associated with early-stage non-small cell lung cancer.
23728940 we report significant associations with overall survival and distant failure for certain VEGF(VEGF-B) family members.
23697367 Data indicate that three miRs (miR-484, -642, and -217) were able to predict chemoresistance and vasculature of serous epithelial ovarian carcinomas through the regulation of the VEGFB and VEGFR2 pathways.
23553333 High VEGFB expression is associated with bone marrow metastasis in neuroblastoma.
23444216 Studies indicate that as a decoy VEGF receptor, aflibercept (VEGF-Trap) has binding affinity for VEGF-A, VEGF-B and placenta growth factor PGF.
23417498 VEGF-B might be an important ligand in the signalling between the tumor and preexisting blood vessels to ensure a functional blood supply for tumor survival.
23350126 Expression of VEGF-B genes in glioma cell lines U87 is significantly changed under hypoxia and ischemic conditions.
23301033 HIV-1 Tat upregulates members of the PDGF/VEGF growth factor family (PDGFA, VEGFA,VEGFB, VEGFC) in mammary epithelial cells
22872519 VEGF-A has a tendency to over-express in gastro-oesophageal cancers, while VEGF-B does not seem involved in these tumours.
22172722 In WT1 mutant cells, reduced VEGF(165)b was due to lack of WT1-mediated transcriptional repression of the splicing-factor kinase SRPK1
21636803 In systemic sclerosis, a switch from proangiogenic to antiangiogenic VEGF isoforms may have a crucial role in the insufficient angiogenic response to chronic ischemia.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20501651 analysis of binding of vascular endothelial growth factor-B by VEGFR-1(D2)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20308035 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20223440 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910455 studies of up-regulation of VEGF in endometrial stromal cells: possible role of retinoic acid as endogenous co-regulator
19424629 VEGF-B mRNA was not expressed either in normal urothelium or in bladder cancer.
18930733 The structural features of the 'highly ordered' interaction of the Fab fragment of the antibody (Fab-2H10) with VEGF-B, is presented.
18757827 Overexpression of vascular endothelial growth factor-B in mouse heart alters cardiac lipid metabolism and induces myocardial hypertrophy.
18564921 Observational study of gene-disease association. (HuGE Navigator)
18537151 Increased VEGFB expression is associated with hepatocellular carcinoma
18511699 VEGF-B appears to have a relatively restricted angiogenic activity in the ischemic heart.
18317782 VEGFB, and receptor were highly expressed in dysplastic neurons. IR in astroglial and balloon cells was observed for VEGFA and its receptors Double-labeling also showed expression of VEGFA, VEGFB and VEGFR-1 in cells of the microglia/macrophage lineage.
17082651 Basophils could play a role in angiogenesis and inflammation through the expression of several forms of VEGF-B and their receptors.
16839256 iodide at high concentration decreases the expression of the angiogenic factors VEGF-A, VEGF-B, and PG
16616187 Results describe the crystal structure of human vascular endothelial growth factor-B (VEGF-B) and present a predicted model for the association of VEGF-B with the second domain of its receptor, VEGFR-1.
15857508 HIV-1 Tat upregulates members of the PDGF/VEGF growth factor family (PDGFA, VEGFA,VEGFB, VEGFC) in mammary epithelial cells
15009103 VEGF family proteins regulate wound healing, chronic inflammation and tumour angiogenesis and lymphangiogenesis in fibroblasts.
12652295 TIMP3 blocks the binding of VEGF to VEGF receptor-2 and inhibits downstream signaling and angiogenesis.

AA Sequence

MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVP      1 - 70
SCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT     71 - 140
PHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA       141 - 207
//

Text Mined References (59)

PMID Year Title
26422603 2015 Bioinformatics Analyses of the Role of Vascular Endothelial Growth Factor in Patients with Non-Small Cell Lung Cancer.
25977072 2015 Alterations in plasma vascular endothelial growth factor levels in patients with schizophrenia before and after treatment.
25633991 2015 Frameshift mutation of an angiogenesis factor VEGFB and its mutational heterogeneity in colorectal cancers.
25435370 2015 Fluid shear promotes chondrosarcoma cell invasion by activating matrix metalloproteinase 12 via IGF-2 and VEGF signaling pathways.
25424698 2015 Vascular endothelial growth factor B coordinates metastasis of non-small cell lung cancer.
25001655 Clinical association of circulating VEGF-B levels with hyperlipidemia and target organ damage in type 2 diabetic patients.
24987705 2014 Roles of vascular endothelial growth factor in amyotrophic lateral sclerosis.
24987005 2014 Vascular endothelial growth factor-B in physiology and disease.
24374930 2014 Effects of vascular endothelial growth factor B on proliferation and migration in EA.Hy926 cells.
24145997 2014 A gene signature combining the tissue expression of three angiogenic factors is a prognostic marker in early-stage non-small cell lung cancer.
23728940 2013 Bladder preservation therapy for muscle-invading bladder cancers on Radiation Therapy Oncology Group trials 8802, 8903, 9506, and 9706: vascular endothelial growth factor B overexpression predicts for increased distant metastasis and shorter survival.
23697367 2013 A microRNA signature defines chemoresistance in ovarian cancer through modulation of angiogenesis.
23553333 2013 Identification of novel biomarkers in neuroblastoma associated with the risk for bone marrow metastasis: a pilot study.
23444216 2013 Aflibercept.
23417498 2013 VEGF-B expression in colorectal carcinomas and its relevance for tumor progression.
23350126 2012 [Changing of the expression of VEGF genes encoded important regulators of angiogenesis and neurogenesis under hypoxic and ischemic conditions].
22872519 2013 VEGF-A and VEGF-B mRNA expression in gastro-oesophageal cancers.
22172722 2011 WT1 mutants reveal SRPK1 to be a downstream angiogenesis target by altering VEGF splicing.
21636803 2011 Overexpression of VEGF165b, an inhibitory splice variant of vascular endothelial growth factor, leads to insufficient angiogenesis in patients with systemic sclerosis.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20501651 2010 Structural insights into the binding of vascular endothelial growth factor-B by VEGFR-1(D2): recognition and specificity.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20308035 2010 Common genetic variation, residential proximity to traffic exposure, and left ventricular mass: the multi-ethnic study of atherosclerosis.
20228789 2010 Vascular endothelial growth factor B controls endothelial fatty acid uptake.
20223440 2010 Allelic variations in angiogenic pathway genes are associated with preeclampsia.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910455 2010 Retinoic acid is a cofactor for translational regulation of vascular endothelial growth factor in human endometrial stromal cells.
19483306 2009 Serum tenascin-X strongly binds to vascular endothelial growth factor.
19424629 2009 Expression analysis of VEGF-A and VEGF-B: relationship with clinicopathological parameters in bladder cancer.
19275959 2009 Vascular endothelial growth factors synthesized by human lung mast cells exert angiogenic effects.
18930733 2008 Crystal structure of vascular endothelial growth factor-B in complex with a neutralising antibody Fab fragment.
18757827 2008 Overexpression of vascular endothelial growth factor-B in mouse heart alters cardiac lipid metabolism and induces myocardial hypertrophy.
18564921 2008 Candidate gene analysis in primary lymphedema.
18537151 2008 Correlations of the expression of vascular endothelial growth factor B and its isoforms in hepatocellular carcinoma with clinico-pathological parameters.
18511699 2008 Reevaluation of the role of VEGF-B suggests a restricted role in the revascularization of the ischemic myocardium.
18317782 2008 Cellular distribution of vascular endothelial growth factor A (VEGFA) and B (VEGFB) and VEGF receptors 1 and 2 in focal cortical dysplasia type IIB.
18259607 2008 VEGF-B inhibits apoptosis via VEGFR-1-mediated suppression of the expression of BH3-only protein genes in mice and rats.
17082651 2006 Expression and functions of the vascular endothelial growth factors and their receptors in human basophils.
16839256 2006 Iodide inhibits vascular endothelial growth factor-A expression in cultured human thyroid follicles: a microarray search for effects of thyrotropin and iodide on angiogenesis factors.
16616187 2006 Crystal structure of human vascular endothelial growth factor-B: identification of amino acids important for receptor binding.
16570043 2006 COX-2-mediated stimulation of the lymphangiogenic factor VEGF-C in human breast cancer.
16109918 2005 Transgenic overexpression of vascular endothelial growth factor-B isoforms by endothelial cells potentiates postnatal vessel growth in vivo and in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15009103 2004 Comparative expression of vascular endothelial growth factor family members, VEGF-B, -C and -D, by normal human keratinocytes and fibroblasts.
12881472 2003 All in the family: VEGF-B joins the ranks of proangiogenic cytokines.
12652295 2003 A novel function for tissue inhibitor of metalloproteinases-3 (TIMP3): inhibition of angiogenesis by blockage of VEGF binding to VEGF receptor-2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12366396 2002 Human vascular endothelial growth factor B: characterization of recombinant isoforms and generation of neutralizing monoclonal antibodies.
11122379 2000 Extracellular matrix tenascin-X in combination with vascular endothelial growth factor B enhances endothelial cell proliferation.
10409677 1999 Differential binding of vascular endothelial growth factor B splice and proteolytic isoforms to neuropilin-1.
9751730 1998 Vascular endothelial growth factor B (VEGF-B) binds to VEGF receptor-1 and regulates plasminogen activator activity in endothelial cells.
9684805 1998 Peripheral blood platelets express VEGF-C and VEGF which are released during platelet activation.
9365524 1997 Vascular endothelial growth factors VEGF-B and VEGF-C.
8919691 1996 Cloning and characterization of a novel human gene related to vascular endothelial growth factor.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8702615 1996 Genomic organization of the mouse and human genes for vascular endothelial growth factor B (VEGF-B) and characterization of a second splice isoform.
8637916 1996 Vascular endothelial growth factor B, a novel growth factor for endothelial cells.