Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.63
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 4.7e-03
Astrocytoma, Pilocytic -1.300 8.8e-05
atypical teratoid / rhabdoid tumor -1.100 1.9e-02
ependymoma -1.300 4.4e-05
glioblastoma -1.300 4.2e-04
intraductal papillary-mucinous adenoma (... 1.100 4.2e-02
intraductal papillary-mucinous neoplasm ... 1.500 4.0e-02
Pick disease -1.800 2.3e-04
subependymal giant cell astrocytoma -1.046 2.3e-02

Gene RIF (2)

AA Sequence

MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRS      1 - 70
VLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDFI     71 - 140
LMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEY    141 - 210
RSEDIHIIYIRKKKSKFPS                                                       211 - 229
//

Text Mined References (8)

PMID Year Title