Property Summary

NCBI Gene PubMed Count 63
PubMed Score 69.01
PubTator Score 59.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.389 1.8e-02
malignant mesothelioma 1.800 1.2e-05
astrocytic glioma -1.800 4.0e-03
ependymoma -1.600 7.2e-03
oligodendroglioma -1.600 4.4e-03
medulloblastoma -1.100 4.8e-04
intraductal papillary-mucinous adenoma (... -3.800 2.8e-06
intraductal papillary-mucinous carcinoma... -3.300 9.6e-04
intraductal papillary-mucinous neoplasm ... -3.900 1.6e-04
colon cancer -2.600 2.9e-03
ulcerative colitis -2.500 4.3e-06
interstitial cystitis -2.400 1.3e-04
cystic fibrosis and chronic rhinosinusit... 1.313 3.9e-02
lung carcinoma -1.500 7.7e-15
breast carcinoma 1.400 1.7e-12
ductal carcinoma in situ 2.600 1.6e-03
invasive ductal carcinoma 3.300 3.1e-03
ovarian cancer 1.200 1.7e-02
pancreatic cancer -1.100 7.4e-03

Gene RIF (41)

PMID Text
26337083 Data show although no any significant differences between patient groups and lean subjects of proteins SYT4, BAG3, APOA1, and VAV3, except for VGF protein, there was a trend between the expression of these four genes and their protein levels.
25964534 discrete and different functions of VAV3.1 in metastasis and tumorigenesis are conceivable.
25791293 VAV3 overexpression could be a useful marker for predicting the outcomes of CRC patients and that VAV3 targeting represents a potential modality for treating CRC
25715123 VAV3 overexpression is a novel biomarker for poor prognosis and survival in ovarian carcinoma.
25430880 Inhibition of Vav3 could reverse the drug resistance of gastric cancer cells by downregulating JNK signaling pathway.
25305756 A new genome-wide significant association between VAV3 and IgA nephropathy.
24886537 This study proposes VAV3 as a biomarker and a rationale for its use as a signaling target to prevent and/or overcome resistance to endocrine therapy in breast cancer.
24072493 Vav3 is involved in the proliferation, migration, and invasion of gastric cancer cell as a tumor oncogene
23566222 Interrupting Vav3 signaling enhances docetaxel-induced apoptosis in LNCaP cells under chronic hypoxia by inhibiting the PI3K/Akt, ERK, and AR signaling pathways.
23403204 Data indicate that Vav3 oncogene protein plays a crucial role in prostate cancer growth and malignant behavior, and could be a potential therapeutic target.
23402756 Two variants of VAV2 and VAV3, rs2156323 and rs2801219, respectively, were identified in Japanese patients with primary open angle glaucoma, normal tension glaucoma, and developmental glaucoma.
23281476 analysis of a novel interaction between the co-chaperone Cdc37 and Rho GTPase exchange factor Vav3 promotes androgen receptor activity and prostate cancer growth
23033540 Data indicate that Vav2 and Vav3 controlled a vast transcriptional program in breast cancer cells through mechanisms that were shared between the two proteins, isoform-specific or synergistic.
23033535 Studies indicate relevance of P-Rex1 and P-Rex2a, in breast tumorigenesis, and suggest that the exchange factors Vav2 and Vav3 play synergistic roles in breast cancer by sustaining tumor growth, neoangiogenesis, and metastasis.
23023561 These data, which demonstrate physical and functional interactions between Vav3 and an AR splice variant, provide insights into the mechanisms by which Vav3 exploits and enhances AR signaling in the progression to castration-resistant prostate cancer.
22659453 Among patients with stage IIB or earlier prostate cancer, higher Vav3 expression correlated with lower cumulative biochemical failure-free survival, suggesting that Vav3 may represent a prognostic marker for posttreatment recurrence of prostate cancer.
22544459 Study suggests that overexpression of guanine nucleotide exchange factor Vav3 can be a useful marker for predicting the outcome of patients with gastric cancer and that Vav3 targeting can represent a potential modality for treating gastric cancer.
22493691 Novel associations for hypothyroidism and autoimmune risk loci include SNPs near the VAV3 gene.
22416266 VAV3 can be seen as novel candidate gene for schizophrenia in which both rare and common variants may be related to increased genetic risk in a Japanese population. rs1410403 might affect the volume of the left temporal gyri.
21765461 Data show the importance of Vav3 in castration-resistant prostate cancer (CRPC) and define a nuclear function of Vav3 in regulating androgen receptor (AR) activity.
21455584 These data revealed that Vav3 overexpression as an additional underlying mechanism contributes to elevated sPLA2-IIa expression in prostate cancer
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20463313 present data indicate a lack of involvement of variations in NTF4, VAV2, and VAV3 with glaucoma pathogenesis in an Indian population.
20463313 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20140222 Data strongly suggest that VAV2 and VAV3 genes are susceptibility loci in Japanese primary open-angle glaucoma.
20126983 Vav3 may enhance non-genomic AR activity via PI3K-Akt signaling in addition to AR transcriptional activity, showing that it may have a role in androgen-independent growth in prostate cancer
19913121 Observational study of gene-disease association. (HuGE Navigator)
19911011 Observational study of gene-disease association. (HuGE Navigator)
19546854 Proteins beta3 integrin, Vav3, Plekhm1, and Src, implicated in attachment defects, had normal exon sequences in a new type of osteopetrosis.
19429868 Observational study of gene-disease association. (HuGE Navigator)
19008376 Data show that Trio, Ect2, and Vav3 are expressed at higher levels in glioblastoma versus low-grade glioma, and are involved in tumor cell migration and invasion.
18518979 Findings suggest that Vav3 overexpression may aberrantly enhance ERalpha-mediated signaling axis and play a role in breast cancer development and/or progression.
18079321 Constitutively active Vav3 mediates ligand-independent transcriptional activation and promotes nuclear localization pf the androgen receptor in prostate neoplsms.
16762975 Vav3 oncogene is overexpressed and regulates cell growth and androgen receptor activity in human prostate cancer development and progression.
16384856 Vav3 levels rise during prostate cancer progression to androgen independence.
15708849 TCR-induced association of Vav3 with SLP-76 is required for its membrane/IS localization and function
15456756 results demonstrate that Vav3 and Vav1 play crucial but redundant roles in the activation of phospholipase C gamma 2 by glycoprotein GPVI
12400014 We present here a novel stimulatory mechanism of Vav3 in which APS directly relieves the autoinhibitory CH domain and furthermore enhances its tyrosine phosphorylation by Lck.
11805146 Vav3 regulates the B cell responses by promoting the sustained production of PIP3 and thereby calcium flux
9269777 HIV-1 gp160 alone or CD4/gp160 cross-linking induces tyrosine phosphorylation of intracellular substrates p59fyn, zap 70, and p95vav and also leads to ras activation

AA Sequence

MEPWKQCAQWLIHCKVLPTNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEINLRPQMSQFL      1 - 70
CLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPIALATGIRPFPTEESINDEDI     71 - 140
YKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLAEIKQTEEKYTET    141 - 210
LESIEKYFMAPLKRFLTAAEFDSVFINIPELVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQ    211 - 280
YCSGVESAISSLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTE    281 - 350
KANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER    351 - 420
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLK    421 - 490
KKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVD    491 - 560
NCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKG    561 - 630
DAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRT    631 - 700
KESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPE    701 - 770
HSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS    771 - 840
TYVEEDE                                                                   841 - 847
//

Text Mined References (67)

PMID Year Title
26337083 2015 Age-related obesity and type 2 diabetes dysregulate neuronal associated genes and proteins in humans.
25964534 2015 Differential Gene Expression of the Proto-oncogene VAV3 and the Transcript Variant VAV3.1 in Oral Squamous Cell Carcinoma.
25791293 2015 VAV3 oncogene expression in colorectal cancer: clinical aspects and functional characterization.
25715123 2015 VAV3 Overexpressed in Cancer Stem Cells Is a Poor Prognostic Indicator in Ovarian Cancer Patients.
25430880 2014 Inhibition of Vav3 could reverse the drug resistance of gastric cancer cells by downregulating JNK signaling pathway.
25305756 2014 Discovery of new risk loci for IgA nephropathy implicates genes involved in immunity against intestinal pathogens.
24886537 2014 VAV3 mediates resistance to breast cancer endocrine therapy.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24722205 2014 A genome-wide association study on thyroid function and anti-thyroid peroxidase antibodies in Koreans.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
24072493 2014 Inhibition of gastric cancer cell growth and invasion through siRNA-mediated knockdown of guanine nucleotide exchange factor Vav3.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23566222 2013 Targeting the Vav3 oncogene enhances docetaxel-induced apoptosis through the inhibition of androgen receptor phosphorylation in LNCaP prostate cancer cells under chronic hypoxia.
23403204 2014 The Vav3 oncogene enhances the malignant potential of prostate cancer cells under chronic hypoxia.
23402756 2013 Molecular genetic analysis of primary open-angle glaucoma, normal tension glaucoma, and developmental glaucoma for the VAV2 and VAV3 gene variants in Japanese subjects.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23281476 2013 Novel interaction between the co-chaperone Cdc37 and Rho GTPase exchange factor Vav3 promotes androgen receptor activity and prostate cancer growth.
23033540 2012 The rho exchange factors vav2 and vav3 control a lung metastasis-specific transcriptional program in breast cancer cells.
23033535 2012 Rho GEFs and cancer: linking gene expression and metastatic dissemination.
23023561 2012 Vav3 enhances androgen receptor splice variant activity and is critical for castration-resistant prostate cancer growth and survival.
22659453 2012 Vav3-rac1 signaling regulates prostate cancer metastasis with elevated Vav3 expression correlating with prostate cancer progression and posttreatment recurrence.
22544459 2012 Clinical significance of increased guanine nucleotide exchange factor Vav3 expression in human gastric cancer.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
22467863 2012 Radixin regulates cell migration and cell-cell adhesion through Rac1.
22416266 2013 Analysis of the VAV3 as candidate gene for schizophrenia: evidences from voxel-based morphometry and mutation screening.
21765461 2012 A novel nuclear role for the Vav3 nucleotide exchange factor in androgen receptor coactivation in prostate cancer.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
21455584 2011 Vav3 oncogene is involved in regulation of secretory phospholipase A2-IIa expression in prostate cancer.
20936779 2010 A human MAP kinase interactome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20463313 2010 Variations in NTF4, VAV2, and VAV3 genes are not involved with primary open-angle and primary angle-closure glaucomas in an indian population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20140222 2010 VAV2 and VAV3 as candidate disease genes for spontaneous glaucoma in mice and humans.
20126983 2010 The molecular mechanism of Vav3 oncogene on upregulation of androgen receptor activity in prostate cancer cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19546854 2009 Osteopetrosis with micro-lacunar resorption because of defective integrin organization.
19429868 2009 A functional genomics approach reveals novel quantitative trait loci associated with platelet signaling pathways.
19008376 2008 The guanine nucleotide exchange factors trio, Ect2, and Vav3 mediate the invasive behavior of glioblastoma.
18654987 2008 Identification of multi-SH3 domain-containing protein interactome in pancreatic cancer: a yeast two-hybrid approach.
18518979 2008 Vav3 oncogene activates estrogen receptor and its overexpression may be involved in human breast cancer.
18079321 2008 Ligand-independent activation of androgen receptors by Rho GTPase signaling in prostate cancer.
17875758 2007 ATM, CTLA4, MNDA, and HEM1 in high versus low CD38 expressing B-cell chronic lymphocytic leukemia.
16982329 2006 Constitutive c-jun N-terminal kinase activity in acute myeloid leukemia derives from Flt3 and affects survival and proliferation.
16782872 2006 Essential role of Vav family guanine nucleotide exchange factors in EphA receptor-mediated angiogenesis.
16762975 2006 Vav3 oncogene is overexpressed and regulates cell growth and androgen receptor activity in human prostate cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16384856 2006 Vav3, a Rho GTPase guanine nucleotide exchange factor, increases during progression to androgen independence in prostate cancer cells and potentiates androgen receptor transcriptional activity.
15708849 2005 Membrane localization and function of Vav3 in T cells depend on its association with the adapter SLP-76.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456756 2004 Vav1 and vav3 have critical but redundant roles in mediating platelet activation by collagen.
14757747 2004 Differential regulation of TCR-mediated gene transcription by Vav family members.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12577067 2003 A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12400014 2002 Adaptor protein APS binds the NH2-terminal autoinhibitory domain of guanine nucleotide exchange factor Vav3 and augments its activity.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
11805146 2002 Vav3 modulates B cell receptor responses by regulating phosphoinositide 3-kinase activation.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11094073 2000 Vav3 mediates receptor protein tyrosine kinase signaling, regulates GTPase activity, modulates cell morphology, and induces cell transformation.
10713454 2000 Major transcript variants of VAV3, a new member of the VAV family of guanine nucleotide exchange factors.
10523675 1999 Biological and regulatory properties of Vav-3, a new member of the Vav family of oncoproteins.
9705494 1998 Non-stoichiometric reduced complexity probes for cDNA arrays.
8990121 1997 Phosphotyrosine-dependent activation of Rac-1 GDP/GTP exchange by the vav proto-oncogene product.
8622875 1996 SH3 domain-dependent interaction of the proto-oncogene product Vav with the focal contact protein zyxin.