Property Summary

NCBI Gene PubMed Count 70
PubMed Score 74.02
PubTator Score 59.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active ulcerative colitis -1.040 1.2e-02
astrocytic glioma -1.800 4.0e-03
breast carcinoma 1.200 7.9e-10
colon cancer -2.600 2.9e-03
cystic fibrosis -1.200 7.4e-03
cystic fibrosis and chronic rhinosinusit... 1.313 3.9e-02
ductal carcinoma in situ 2.600 1.6e-03
ependymoma -1.600 7.2e-03
group 4 medulloblastoma -1.100 1.5e-03
interstitial cystitis -1.800 7.1e-03
intraductal papillary-mucinous adenoma (... -1.100 1.9e-05
intraductal papillary-mucinous carcinoma... -3.300 9.6e-04
intraductal papillary-mucinous neoplasm ... -3.900 1.6e-04
invasive ductal carcinoma 3.300 3.1e-03
lung carcinoma -1.500 7.7e-15
malignant mesothelioma 1.800 1.2e-05
oligodendroglioma -1.600 4.4e-03
ovarian cancer 1.200 1.7e-02
pancreatic cancer -1.100 7.4e-03
Waldenstrons macroglobulinemia -1.389 1.8e-02

Protein-protein Interaction (4)

Gene RIF (48)

AA Sequence

MEPWKQCAQWLIHCKVLPTNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEINLRPQMSQFL      1 - 70
CLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPIALATGIRPFPTEESINDEDI     71 - 140
YKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLAEIKQTEEKYTET    141 - 210
LESIEKYFMAPLKRFLTAAEFDSVFINIPELVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQ    211 - 280
YCSGVESAISSLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTE    281 - 350
KANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER    351 - 420
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLK    421 - 490
KKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVD    491 - 560
NCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKG    561 - 630
DAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRT    631 - 700
KESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPE    701 - 770
HSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS    771 - 840
TYVEEDE                                                                   841 - 847
//

Text Mined References (74)

PMID Year Title