Property Summary

NCBI Gene PubMed Count 49
PubMed Score 94.21
PubTator Score 52.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 6.9e-05
Atopic dermatitis -1.200 8.0e-03
atypical teratoid / rhabdoid tumor 1.100 1.5e-02
dermatomyositis -1.100 1.7e-02
Down syndrome 2.600 7.7e-04
ependymoma 1.800 7.5e-10
esophageal adenocarcinoma -1.400 3.2e-02
gastric cancer -1.300 1.8e-02
Gaucher disease type 1 -1.400 2.4e-02
glioblastoma 1.400 6.8e-03
group 4 medulloblastoma -1.600 2.1e-04
invasive ductal carcinoma -1.100 4.7e-03
lung adenocarcinoma 1.422 2.1e-04
lung cancer -1.300 3.2e-03
malignant mesothelioma -1.100 4.3e-06
medulloblastoma, large-cell -1.600 5.8e-04
Multiple myeloma 1.303 9.1e-04
osteosarcoma 1.848 4.9e-04
ovarian cancer -2.100 1.0e-09
pancreatic cancer -1.300 2.4e-02
pancreatic carcinoma -1.300 2.4e-02
pediatric high grade glioma 1.300 5.2e-03
primary pancreatic ductal adenocarcinoma 1.055 9.5e-03
psoriasis 1.100 8.0e-04

Protein-protein Interaction (5)

Gene RIF (20)

AA Sequence

MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRK      1 - 70
YWWKNCKMWAIGITVLVIFIIIIIVWVVSS                                             71 - 100
//

Text Mined References (54)

PMID Year Title