Property Summary

NCBI Gene PubMed Count 12
PubMed Score 18.25
PubTator Score 13.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma 1.100 2.6e-05
group 4 medulloblastoma 1.600 1.1e-04
medulloblastoma, large-cell 1.200 2.6e-05
osteosarcoma 1.134 1.8e-05
ovarian cancer -1.700 7.4e-09
pancreatic ductal adenocarcinoma liver m... -1.329 1.4e-03
spina bifida -1.227 4.3e-02
tuberculosis and treatment for 6 months 1.100 3.1e-03
ulcerative colitis -1.100 9.4e-05

Gene RIF (6)

AA Sequence

MLSSRAEAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERKKRRKGLVPGL      1 - 70
VNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTLLHLLKALSCQEVTDDEVLDA     71 - 140
SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGS    141 - 210
PHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVR    211 - 280
DVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLM    281 - 350
MDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMP    351 - 420
FPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVL    421 - 490
SSSAYLLFYERVLSRMQHQSQECKSEE                                               491 - 517
//

Text Mined References (13)

PMID Year Title