Property Summary

NCBI Gene PubMed Count 35
PubMed Score 68.21
PubTator Score 42.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 1.1e-51

Protein-protein Interaction (3)

Gene RIF (21)

PMID Text
26240016 USP18 negatively regulates NF-kappaB signaling by targeting TAK1 and NEMO for deubiquitination through distinct mechanisms.
26116899 HIV-1 Vpr upregulates the gene expression of USP18 in human monocyte-derived dendritic cells
26046984 Data suggest that USP18 (Ubiquitin-like specific protease 18) sensitive cellular functions include activity of the peptide transporters PEPT1 and PEPT2.
26008745 Dimerization of IFNAR1 and IFNAR2 and the limiting role of IFNAR1 binding affinity in complex assembly is modulated by USP18.
24955730 increased expression in the HIV+/HCV+ female patients group compared with HIV-/HCV+ and HIV+/HCV- groups
24742347 HIV-1 Vpr upregulates the gene expression of USP18 in human monocyte-derived dendritic cells
23700969 USP18 expression levels induced by IFNbeta did not differ amongst multiple sclerosis patients carrying different rs2542109 genotypes
23291318 Usp18 upregulation was associated with Wilms Tumor.
23152055 USP18 inhibition induces inflammation by increasing the STAT signaling and exacerbates IFN-induced beta cell apoptosis.
22752428 A direct relationship was found between UBP43 and cyclin D1 (but not cyclin E) expression.
22731491 USP18 establishes the transcriptional and anti-proliferative interferon alpha/beta differential
22683641 although UBP43 depletion can cause hypersensitivity to interferon-alpha/beta-mediated apoptosis in a broad range of cell types, the downstream pathway may vary depending on the cell type.
22677194 USP18 is up-regulated in liver samples of patients with chronic hepatitis C that did not respond to therapy, but not in patients with acute hepatitis C.
22170061 the existence of an N-terminal truncated isoform of USP18, whose expression is controlled on translational level by two independent mechanisms providing translational flexibility
22100648 Inhibition of R. conorii-induced ISG15 by RNA interference results in significant increase in the extent of rickettsial replication, whereas UBP43 knockdown yields a reciprocal inhibitory effect.
21592959 a model in which Usp18 inhibition promotes up-regulation of miR-7, which in turn inhibits EGFR expression and the tumorigenic activity of cancer cells.
20935222 Findings define the ubiquitin protease UBP43 as a novel candidate drug target for APL treatment.
20068173 Findings suggest that USP18 may significantly limit operation of the extrinsic apoptotic pathway triggered by type I IFN and drugs.
19551150 Epstein-Barr virus independent dysregulation of UBP43 expression alters interferon-stimulated gene expression in Burkitt lymphoma
17374743 Ubp43 deficiency increases the resistance to oncogenic transformation by BCR-ABL
15342634 UBP43 protein levels are regulated by proteolysis via the SCFSkp2 ubiquitin ligase

AA Sequence

MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNIGQTCCLNSLI      1 - 70
QVFVMNVDFTRILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVRPLELAYCLQKCNVPLFVQHDA     71 - 140
AQLYLKLWNLIKDQITDVHLVERLQALYTIRVKDSLICVDCAMESSRNSSMLTLPLSLFDVDSKPLKTLE    141 - 210
DALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLD    211 - 280
FSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCT    281 - 350
YGNPNYHWQETAYLLVYMKMEC                                                    351 - 372
//

Text Mined References (36)

PMID Year Title
26240016 2015 USP18 negatively regulates NF-?B signaling by targeting TAK1 and NEMO for deubiquitination through distinct mechanisms.
26046984 2015 USP18 Sensitivity of Peptide Transporters PEPT1 and PEPT2.
26008745 2015 Receptor dimerization dynamics as a regulatory valve for plasticity of type I interferon signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24955730 2014 Systemic cytokine and interferon responsiveness Patterns in HIV and HCV mono and co-infections.
23700969 2013 Roles of the ubiquitin peptidase USP18 in multiple sclerosis and the response to interferon-? treatment.
23291318 2013 Ubiquitin specific protease 18 (Usp18) is a WT1 transcriptional target.
23152055 2012 USP18 is a key regulator of the interferon-driven gene network modulating pancreatic beta cell inflammation and apoptosis.
22752428 2012 Evidence for the ubiquitin protease UBP43 as an antineoplastic target.
22731491 2012 USP18 establishes the transcriptional and anti-proliferative interferon ?/? differential.
22683641 2012 The mitochondrial pathway and reactive oxygen species are critical contributors to interferon-?/?-mediated apoptosis in Ubp43-deficient hematopoietic cells.
22677194 2012 Interferon-?-stimulated genes, but not USP18, are expressed in livers of patients with acute hepatitis C.
22170061 2012 Two independent mechanisms promote expression of an N-terminal truncated USP18 isoform with higher DeISGylation activity in the nucleus.
22100648 2011 Rickettsia conorii infection stimulates the expression of ISG15 and ISG15 protease UBP43 in human microvascular endothelial cells.
21592959 2011 Usp18 regulates epidermal growth factor (EGF) receptor expression and cancer cell survival via microRNA-7.
20935222 2010 Blockade of the ubiquitin protease UBP43 destabilizes transcription factor PML/RAR? and inhibits the growth of acute promyelocytic leukemia.
20068173 2010 Identification of USP18 as an important regulator of the susceptibility to IFN-alpha and drug-induced apoptosis.
19551150 2009 Epstein-Barr virus independent dysregulation of UBP43 expression alters interferon-stimulated gene expression in Burkitt lymphoma.
17374743 2007 Ubp43 regulates BCR-ABL leukemogenesis via the type 1 interferon receptor signaling.
16710296 2006 UBP43 is a novel regulator of interferon signaling independent of its ISG15 isopeptidase activity.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15342634 2004 The ISG15 isopeptidase UBP43 is regulated by proteolysis via the SCFSkp2 ubiquitin ligase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11788588 2002 UBP43 (USP18) specifically removes ISG15 from conjugated proteins.
11313150 2001 Cloning and characterization of human ubiquitin-processing protease-43 from terminally differentiated human melanoma cells using a rapid subtraction hybridization protocol RaSH.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10777664 2000 Cloning and characterization of a novel human ubiquitin-specific protease, a homologue of murine UBP43 (Usp18).
10722734 2000 RNase-L-dependent destabilization of interferon-induced mRNAs. A role for the 2-5A system in attenuation of the interferon response.