Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.57
PubTator Score 7.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.200 1.0e-02
ependymoma -1.200 2.2e-02
osteosarcoma -1.986 6.4e-05
glioblastoma -1.800 1.7e-06
atypical teratoid / rhabdoid tumor -1.700 5.6e-08
medulloblastoma -1.500 1.4e-07
medulloblastoma, large-cell -2.000 2.8e-06
primitive neuroectodermal tumor -1.200 1.7e-04
juvenile dermatomyositis 1.032 8.3e-09
adult high grade glioma -1.400 3.1e-04
ovarian cancer -1.500 3.7e-05

Synonym

Accession O75317 A8K0X0 Q5VZV3 Q8TC49
Symbols UBH1
USP12L1

Gene

PDB

5K16   5K1A   5K1B   5K1C  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (9)

PMID Text
26811477 Usp12 deubiquitylates and prevents lysosomal degradation of LAT and Trat1 to maintain the proximal TCR complex for the duration of signaling.
25855980 Results suggest role for USP46/USP12 in Epstein-Barr virus induced growth transformation.
25216524 Usp12 directly deubiquitinates and stabilises the Akt phosphatases PHLPP and PHLPPL resulting in decreased levels of active pAkt.
24850727 Coimmunoprecipitation experiments indicated that human papillomavirus type 31 E1 assembles into a ternary complex with UAF1 and any one of these three USPs: USP1, USP12 and USP46.
24145035 our results reveal WDR48 and USP12 as novel PHLPP1 regulators and potential suppressors of tumor cell survival
24056413 Usp12 acts in a pro-proliferative manner by stabilizing AR and enhancing its cellular function.
22778262 The ubiquitin-specific protease 12 (USP12) is a negative regulator of notch signaling acting on notch receptor trafficking toward degradation.
20147737 WDR20 serves as a stimulatory subunit for preserving and regulating the activity of the subset of the UAF1 x USP12 complexes
19075014 two novel multisubunit deubiquitinating enzyme complexes containing USP12 and USP46, respectively. Both complexes contain the UAF1 protein as a bona fide subunit. Interestingly, UAF1

AA Sequence

MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAY      1 - 70
KSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADIL     71 - 140
QEERKQEKQNGRLPNGNIDNENNNSTPDPTWVHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNT    141 - 210
SITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVF    211 - 280
PLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGL    281 - 350
TSDISKNSESGYILFYQSRD                                                      351 - 370
//

Text Mined References (17)

PMID Year Title
26811477 2016 Usp12 stabilizes the T-cell receptor complex at the cell surface during signaling.
25855980 2015 The EBNA3 family of Epstein-Barr virus nuclear proteins associates with the USP46/USP12 deubiquitination complexes to regulate lymphoblastoid cell line growth.
25216524 2014 Deubiquitinating enzyme Usp12 regulates the interaction between the androgen receptor and the Akt pathway.
24850727 2014 E1-mediated recruitment of a UAF1-USP deubiquitinase complex facilitates human papillomavirus DNA replication.
24145035 2013 WD repeat protein WDR48 in complex with deubiquitinase USP12 suppresses Akt-dependent cell survival signaling by stabilizing PH domain leucine-rich repeat protein phosphatase 1 (PHLPP1).
24056413 2013 Deubiquitinating enzyme Usp12 is a novel co-activator of the androgen receptor.
22778262 2012 The ubiquitin-specific protease 12 (USP12) is a negative regulator of notch signaling acting on notch receptor trafficking toward degradation.
21314694 2011 Genomewide association analysis of symptoms of alcohol dependence in the molecular genetics of schizophrenia (MGS2) control sample.
20147737 2010 WDR20 regulates activity of the USP12 x UAF1 deubiquitinating enzyme complex.
19915573 2009 A genome-wide association study identifies three new susceptibility loci for ulcerative colitis in the Japanese population.
19075014 2009 UAF1 is a subunit of multiple deubiquitinating enzyme complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9615226 1998 An evolutionarily conserved gene on human chromosome 5q33-q34, UBH1, encodes a novel deubiquitinating enzyme.