Property Summary

NCBI Gene PubMed Count 2
PubMed Score 224.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 286 1.8e-02
Disease Target Count Z-score Confidence
Schizophrenia 503 3.505 1.8
Schizoaffective disorder 33 3.058 1.5

 GO Component (1)

AA Sequence

MQQIYTVKEIRSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVR      1 - 70
RPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESTEARKGFSYLVTGVTTVGVAYAAKN     71 - 140
AVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIKQEAAVELSQLRDPQHD    141 - 210
LDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPATLNLEVPTYEFTSDDMV    211 - 280
IVG                                                                       281 - 283
//

Text Mined References (3)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
10591208 1999 The DNA sequence of human chromosome 22.
8088805 1994 Assignment of the gene (UQCRFS1) for the Rieske iron-sulfur protein subunit of the mitochondrial cytochrome bc1 complex to the 22q13 and 19q12-q13.1 regions of the human genome.