Property Summary

NCBI Gene PubMed Count 23
PubMed Score 82.23
PubTator Score 77.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 1.3e-03
interstitial cystitis -4.900 4.3e-05

Gene RIF (6)

PMID Text
25611245 UPII, GATA3, and p40, when used in combination, are highly sensitive in the differential diagnosis of invasive urothelial carcinoma.
25449628 UPII was highly specific/moderately sensitive for urothelial carcinoma. May be a potentially useful marker to identify urothelial lineage and help distinguish UC from prostate cancer or, in conjunction with GATA3, from metastatic breast cancer.
25389341 UPII demonstrates a significantly higher sensitivity than UPIII in conventional and variant urothelial carcinomas
24978921 Uroplakin II antibody BC21 demonstrated superior sensitivity and specificity in urothelial carcinoma, compared with uroplakin III, suggesting an advantage in differential diagnosis of urothelial carcinoma and in the detection of tumors of unknown origin.
18440837 combination of prostate stem cell antigen enhancer and uroplakin II promoter is feasible in constructing bladder cancer-specific vectors
17012268 study offers no definitive support for uroplakin II mutations causing human renal tract malformations

AA Sequence

MAPLLPIRTLPLILILLALLSPGAADFNISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKV      1 - 70
VTSSFVVPPCRGRRELVSVVDSGAGFTVTRLSAYQVTNLVPGTKFYISYLVKKGTATESSREIPMSTLPR     71 - 140
RNMESIGLGMARTGGMVVITVLLSVAMFLLVLGFIIALALGSRK                              141 - 184
//

Text Mined References (23)

PMID Year Title
25611245 Uroplakin II (UPII), GATA3, and p40 are Highly Sensitive Markers for the Differential Diagnosis of Invasive Urothelial Carcinoma.
25449628 2015 Utility of uroplakin II expression as a marker of urothelial carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25389341 2014 Uroplakin II is a more sensitive immunohistochemical marker than uroplakin III in urothelial carcinoma and its variants.
24978921 2014 A newly developed uroplakin II antibody with increased sensitivity in urothelial carcinoma of the bladder.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18440837 Prostate stem cell antigen enhancer and uroplakin II promoter based bladder cancer targeted tissue-specific vector.
17012268 2006 Mutation analyses of Uroplakin II in children with renal tract malformations.
16116969 2005 Cloning of human uroplakin II gene from Chinese transitional cell carcinoma of bladder and construction of its eukaryotic expression vector.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12792753 Genetic detection for hematogenous micrometastasis in patients with various types of malignant tumors using Uroplakin II derived primers in polymerase chain reaction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475947 2002 Specific heterodimer formation is a prerequisite for uroplakins to exit from the endoplasmic reticulum.
12097284 2002 Identification of human uroplakin II promoter and its use in the construction of CG8840, a urothelium-specific adenovirus variant that eliminates established bladder tumors in combination with docetaxel.
10514386 1999 Immunohistochemical analysis of uroplakins, urothelial specific proteins, in ovarian Brenner tumors, normal tissues, and benign and neoplastic lesions of the female genital tract.
10458411 1999 Detection of circulating uroplakin-positive cells in patients with transitional cell carcinoma of the bladder.
10404304 1999 Expression of transitional cell-specific genes, uroplakin Ia and II, in bladder cancer: detection of circulating cancer cells in the peripheral blood of metastatic patients.
9846985 1998 Uroplakin gene expression by normal and neoplastic human urothelium.
9515818 1998 Uroplakin II gene is expressed in transitional cell carcinoma but not in bilharzial bladder squamous cell carcinoma: alternative pathways of bladder epithelial differentiation and tumor formation.
8175808 1994 Mammalian uroplakins. A group of highly conserved urothelial differentiation-related membrane proteins.
7507484 1994 Precursor sequence, processing, and urothelium-specific expression of a major 15-kDa protein subunit of asymmetric unit membrane.