Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.79
PubTator Score 3.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
acute quadriplegic myopathy 1157 4.4e-07
lung adenocarcinoma 2714 1.1e-06
ovarian cancer 8491 1.8e-05
dermatomyositis 966 5.8e-04

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.110 4.4e-07
lung adenocarcinoma -1.100 1.1e-06
ovarian cancer -1.700 1.8e-05
dermatomyositis 1.200 5.8e-04

 GO Function (1)

Gene RIF (2)

PMID Text
25738771 UNC50 may plays some roles in HCC progression by affecting the EGFR pathway
17004066 UNCL plays important roles in the development, differentiation, and maintenance of periodontal tissues and in the mechanotransduction of periodontal ligament fibroblasts.

AA Sequence

MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYR      1 - 70
KQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKY     71 - 140
LVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTF    141 - 210
LGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK                         211 - 259
//

Text Mined References (14)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25738771 2015 UNC50 prompts G1/S transition and proliferation in HCC by regulation of epidermal growth factor receptor trafficking.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17004066 2007 Expression of UNCL during development of periodontal tissue and response of periodontal ligament fibroblasts to mechanical stress in vivo and in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12808035 2003 A novel Golgi membrane protein is a partner of the ARF exchange factors Gea1p and Gea2p.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11302735 2001 Isolation and characterization of cultured human periodental ligament fibroblast-specific cDNAs.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10980252 2000 UNCL, the mammalian homologue of UNC-50, is an inner nuclear membrane RNA-binding protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.