Property Summary

NCBI Gene PubMed Count 72
PubMed Score 47.05
PubTator Score 67.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
psoriasis 6685 1.6e-56
Disease Target Count Z-score Confidence
Pericholangitis 7 3.732 1.9
Disease Target Count
Sickle Cell Anemia 54

Gene RIF (33)

PMID Text
26220143 In further studies with UGT1A10, mutant F93G exhibited increased glucuronidation rates of 16alpha-hydroxyestrone, but not estrone
25547628 UGT1A10 exhibited somewhat higher BPA glucuronidation activity than UGT1A9, but it was lower than UGT2A1 and UGT2B15. 4.
25264962 A graphene nanocage with regulatable space for the assembly of a CYP1A2-UGT1A10 bienzyme complex has been constructed via a click reaction, and used to study drug sequential metabolism using an electrochemically-driven method.
24239897 DNA hypermethylation results in defective expression of UGT1A10 in the liver.
23160818 Suggest that extrahepatic UGT1A10 plays an important role in the metabolism and the bioactivation of the antitumor agent C-1305.
22659092 Triazoloacridinone and imidazoacridinone antitumor agents C-1305 and C-1311 are glucuronidated in human liver and intestine.
22031623 Data suggest that darexaban glucuronidation in jejunum microsomes is mainly catalyzed by UGT1A10; studies include kinetics of recombinant UGT proteins, liver microsomes, and jejunal microsomes (and UGT isoform-specific inhibitors/substrates).
21846474 role of Phenylalanine 93 in UGT1A10
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20297805 The results also indicated that UGT1A1, UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2B7 are the most important six UGT isoforms for metabolizing the three dihydroxyflavones and seven monohydroxyflavones.
20089735 it appears that residues within segment C of the N-terminal domain, mainly at positions 152 and 169, contribute to the higher glucuronidation rates of UGT1A10
20007669 Data point to UGT1A10 as primary UGT isoform metabolizing psilocin (a hallucinogenic indole alkaloid) in small intestine; kinetic studies are included.
20007297 Data suggest that UGT1A10 is important in detoxification of the carcinogen NNAL and that polymorphisms in UGT1A10 promoter (and thus altered gene expression) may be important in susceptibility to hepatocellular carcinoma.
20007297 Observational study of genotype prevalence. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19244109 Observational study of gene-disease association. (HuGE Navigator)
18725508 The binding motif residue phenylalanine-90 appears to be the most significant contributor to glucuronidation of UGT1A10 hydroxywarfarin substrates. Alanine mutation of this residue abolishes activity toward 6- and 7-hydroxywarfarin.
18570380 UDP-glucuronic acid binds to specific sites in this enzyme.
18556656 UDP-glucuronosyltransferase chemical detoxifying system requires regulated phosphorylation supported by protein kinase C
18161889 Observational study of gene-disease association. (HuGE Navigator)
18052087 UGT1A7, UGT1A8, and UGT1A9 were mainly responsible for formation of prunetin-5- O-glucuronide; UGT1A1, UGT1A8, and UGT1A10 were mainly responsible for formation of prunetin-4'- O-glucuronide; thermostability of microsomes was isoform- and organ-dependent
17603215 Results show UGT1A10 mRNA expression in primary hepatocytes by semi-quantitative RT-PCR.
17558305 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16475821 Analysis of recombinant UGTs from 1A family for their ability to glucuronidate p-nitrophenol & 4-methylumbelliferone revealed that UGT1A10 shows high activity toward phenols. Phe(90) & Phe(93) are directly involved in the catalytic activity of UGT1A10.
16019943 structure-function analysis of UGT1A10 and its glucuronidation of bioflavonoids
15117964 gastrointestinally distributed UGT1A10 is important for detoxifying estrogens/phytoestrogens and aromatic acids with complementary activity by UGT1A7, -1A8, -1A3, and/or -1A1 evidently dependent upon phosphorylation
15057901 Observational study of gene-disease association. (HuGE Navigator)
12910533 Observational study of gene-disease association. (HuGE Navigator)
12910533 the UGT1A10 gene has several low-frequency missense polymorphisms and that the codon 139 polymorphism is an independent risk factor for orolaryngeal carcinoma in blacks
12847094 UGT1A8, 1A9, and 1A10 genes are differentially regulated through an initiator element in their 5'-flanking regions

AA Sequence

MARAGWTSPVPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLERSL      1 - 70
NCTVKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLFFSHCRSLFNDRKLVEYLKES     71 - 140
SFDAVFLDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEGAQCPAPLSYVPNDLLGFSDAMTFKERVWNH    141 - 210
IVHLEDHLFCQYLFRNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQG    211 - 280
KPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVK    281 - 350
WLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL    351 - 420
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIG    421 - 490
FLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                                  491 - 530
//

Text Mined References (75)

PMID Year Title
26220143 2015 Glucuronidation of estrone and 16?-hydroxyestrone by human UGT enzymes: The key roles of UGT1A10 and UGT2B7.
25547628 2015 Differences in the glucuronidation of bisphenols F and S between two homologous human UGT enzymes, 1A9 and 1A10.
25264962 2014 Electrochemically driven drug metabolism via a CYP1A2-UGT1A10 bienzyme confined in a graphene nano-cage.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24239897 2014 Epigenetic regulation of the tissue-specific expression of human UDP-glucuronosyltransferase (UGT) 1A10.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23642732 2013 Association of SNPs in the UGT1A gene cluster with total bilirubin and mortality in the Diabetes Heart Study.
23371916 2013 A genome-wide association study for serum bilirubin levels and gene-environment interaction in a Chinese population.
23281178 2013 A genome-wide assessment of variability in human serum metabolism.
23160818 2013 Metabolic transformation of antitumor acridinone C-1305 but not C-1311 via selective cellular expression of UGT1A10 increases cytotoxic response: implications for clinical use.
22659092 2012 Role of human UDP-glucuronosyltransferases in the biotransformation of the triazoloacridinone and imidazoacridinone antitumor agents C-1305 and C-1311: highly selective substrates for UGT1A10.
22558097 2012 A genome-wide association study of total bilirubin and cholelithiasis risk in sickle cell anemia.
22511988 2012 A genome-wide association study identifies UGT1A1 as a regulator of serum cell-free DNA in young adults: The Cardiovascular Risk in Young Finns Study.
22085899 2012 UGT1A1 is a major locus influencing bilirubin levels in African Americans.
22031623 2012 Identification of UDP-glucuronosyltransferases responsible for the glucuronidation of darexaban, an oral factor Xa inhibitor, in human liver and intestine.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21846474 2011 Phenylalanine 93 of the human UGT1A10 plays a major role in the interactions of the enzyme with estrogens.
21646302 2011 Mayo Genome Consortia: a genotype-phenotype resource for genome-wide association studies with an application to the analysis of circulating bilirubin levels.
20972438 2010 A multi-stage genome-wide association study of bladder cancer identifies multiple susceptibility loci.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20732626 2010 Family-based genome-wide association scan of attention-deficit/hyperactivity disorder.
20639394 2010 Genome-wide association of serum bilirubin levels in Korean population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20610558 2010 Alternatively spliced products of the UGT1A gene interact with the enzymatically active proteins to inhibit glucuronosyltransferase activity in vitro.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20308471 2010 Role of UDP-glucuronosyltransferase isoforms in 13-cis retinoic acid metabolism in humans.
20297805 2010 Use of glucuronidation fingerprinting to describe and predict mono- and dihydroxyflavone metabolism by recombinant UGT isoforms and human intestinal and liver microsomes.
20089735 2010 How many and which amino acids are responsible for the large activity differences between the highly homologous UDP-glucuronosyltransferases (UGT) 1A9 and UGT1A10?
20056724 2010 Phase II metabolism of hesperetin by individual UDP-glucuronosyltransferases and sulfotransferases and rat and human tissue samples.
20007669 2010 Glucuronidation of psilocin and 4-hydroxyindole by the human UDP-glucuronosyltransferases.
20007297 2010 UDP-glucuronosyltransferase 1A10: activity against the tobacco-specific nitrosamine, 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanol, and a potential role for a novel UGT1A10 promoter deletion polymorphism in cancer susceptibility.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19545173 Structure and concentration changes affect characterization of UGT isoform-specific metabolism of isoflavones.
19419973 2009 Common variants in the SLCO1B3 locus are associated with bilirubin levels and unconjugated hyperbilirubinemia.
19414484 2009 Genome-wide association meta-analysis for total serum bilirubin levels.
19244109 2009 Functional significance of UDP-glucuronosyltransferase variants in the metabolism of active tamoxifen metabolites.
18725508 2008 Identification of hydroxywarfarin binding site in human UDP glucuronosyltransferase 1a10: phenylalanine90 is crucial for the glucuronidation of 6- and 7-hydroxywarfarin but not 8-hydroxywarfarin.
18570380 2008 Mapping the UDP-glucuronic acid binding site in UDP-glucuronosyltransferase-1A10 by homology-based modeling: confirmation with biochemical evidence.
18556656 2008 The major chemical-detoxifying system of UDP-glucuronosyltransferases requires regulated phosphorylation supported by protein kinase C.
18161889 2008 Detoxification enzyme polymorphisms are not involved in duodenal adenomatosis in familial adenomatous polyposis.
18052087 Disposition of flavonoids via enteric recycling: enzyme stability affects characterization of prunetin glucuronidation across species, organs, and UGT isoforms.
18004212 2007 Genetic diversity at the UGT1 locus is amplified by a novel 3' alternative splicing mechanism leading to nine additional UGT1A proteins that act as regulators of glucuronidation activity.
17603215 2007 Human UGT1A8 and UGT1A10 mRNA are expressed in primary human hepatocytes.
17558305 2007 Irinotecan pharmacokinetics/pharmacodynamics and UGT1A genetic polymorphisms in Japanese: roles of UGT1A1*6 and *28.
17179145 2007 Oligomerization of the UDP-glucuronosyltransferase 1A proteins: homo- and heterodimerization analysis by fluorescence resonance energy transfer and co-immunoprecipitation.
16475821 2006 Phenylalanine 90 and 93 are localized within the phenol binding site of human UDP-glucuronosyltransferase 1A10 as determined by photoaffinity labeling, mass spectrometry, and site-directed mutagenesis.
16019943 2005 Glucuronidation of bioflavonoids by human UGT1A10: structure-function relationships.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15618702 2002 Three novel single nucleotide polymorphisms in UGT1A10.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15117964 2004 Gastrointestinally distributed UDP-glucuronosyltransferase 1A10, which metabolizes estrogens and nonsteroidal anti-inflammatory drugs, depends upon phosphorylation.
15057901 2004 Variation of hepatic glucuronidation: Novel functional polymorphisms of the UDP-glucuronosyltransferase UGT1A4.
14672974 2004 Multiple variable first exons: a mechanism for cell- and tissue-specific gene regulation.
12910533 2003 Detection of UGT1A10 polymorphisms and their association with orolaryngeal carcinoma risk.
12847094 2003 Cloning and characterization of the human UDP-glucuronosyltransferase 1A8, 1A9, and 1A10 gene promoters: differential regulation through an interior-like region.
12695339 2003 Functional characterization of wild-type and variant (T202I and M59I) human UDP-glucuronosyltransferase 1A10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11901093 2002 Glucuronidation: an important mechanism for detoxification of benzo[a]pyrene metabolites in aerodigestive tract tissues.
11465080 2000 UDP-glucuronosyltransferases.
11434514 2001 Thirteen UDPglucuronosyltransferase genes are encoded at the human UGT1 gene complex locus.
11179432 2001 Genetic multiplicity of the human UDP-glucuronosyltransferases and regulation in the gastrointestinal tract.
10836148 2000 Human UDP-glucuronosyltransferases: metabolism, expression, and disease.
10748067 2000 Polymorphic gene regulation and interindividual variation of UDP-glucuronosyltransferase activity in human small intestine.
10497143 1999 Studies on the substrate specificity of human intestinal UDP- lucuronosyltransferases 1A8 and 1A10.
10024527 1999 Regulation and function of family 1 and family 2 UDP-glucuronosyltransferase genes (UGT1A, UGT2B) in human oesophagus.
9647757 1998 Characterization of two UDP glucuronosyltransferases that are predominantly expressed in human colon.
9325166 1997 The human UDP glucuronosyltransferase, UGT1A10, glucuronidates mycophenolic acid.
9295054 1997 The UDP glycosyltransferase gene superfamily: recommended nomenclature update based on evolutionary divergence.
9271343 1997 Differential expression of the UGT1A locus in human liver, biliary, and gastric tissue: identification of UGT1A7 and UGT1A10 transcripts in extrahepatic tissue.
8467709 1993 Assignment of the human UDP glucuronosyltransferase gene (UGT1A1) to chromosome region 2q37.
2108603 1990 Chromosomal mapping of a human phenol UDP-glucuronosyltransferase, GNT1.