Property Summary

NCBI Gene PubMed Count 121
PubMed Score 1148.02
PubTator Score 533.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count Z-score Confidence
diabetes mellitus 1663 4.655 2.3
Disease Target Count Z-score Confidence
Metabolic syndrome X 155 4.121 2.1
Hyperglycemia 120 3.822 1.9
Lipomatosis 11 3.332 1.7
Disease Target Count
Obesity 616

Expression

Gene RIF (125)

PMID Text
26959981 UCP1 and UCP3 expression is associated with lipid and carbohydrate oxidation in patients submitted to bariatric surgery.
26711342 In inguinal white adipose tissue (iWAT) of mice fed a high-fat diet (HFD), Ucp1 level decreases concomitantly with increases in Cnot7 and its interacting partner Tob.
26458326 UCP1 -3826 A>G polymorphism is associated with weight, body fat mass, and risk of type 2 diabetes mellitus in obese individuals candidates for bariatric surgery.
26332421 Findings suggest that polymorphisms in SIRT6/UCP1 genes may be important for increased carotid plaque burden and echodensity
26038550 Uncoupling protein 1 binds one nucleotide per monomer and is stabilized by tightly bound cardiolipin.
25928572 1-3826 A>G polymorphism associated with elevated lipid and apolipoprotein levels in Chinese population
25812254 BMI and TBF were significantly different among UCPI -3826A/G and UCP3 -55C/T genotype combinations, suggesting the existence of a gene interaction between UCP1 and UCP3 in influencing obesity and adiposity in multiethnic Malaysians.
25644605 MED1 is required for optimal PRDM16-induced Ucp1 expression
25389910 this study reveals that human adipose-derived stromal/progenitor cells can be readily differentiated into beige adipocytes that, upon activation, undergo uncoupling protein 1-dependent thermogenesis.
25274455 This study suggests that the SNP rs1800592 in the UCP1 gene is associated with increased risk of PDR in the Chinese type 2 diabetes mellitus population.
25135951 By the application of these findings, we demonstrate that UCP1 is functionally thermogenic in intact brite adipocytes and adrenergic UCP1 activation is largely dependent on adipose triglyceride lipase (ATGL) rather than hormone sensitive lipase (HSL).
24804925 Meta-analysis. There was no significant association of the UCP1-3826A/G polymorphism with BMI mean differences.
24752406 Genotype and allele distributions of UCP1, UCP2 and UCP3 polymorphisms did not differ significantly between obese and non-obese Type 2 Diabetes Mellitus patients.[Meta-analysis]
24642703 In obesity, in vitro differentiated beige/brite adipocytes derived from preadipocytes of human subcutaneous white adipose tissues express less UCP1.
24342393 Human white adipocytes express the cold receptor TRPM8 which activation induces UCP1 expression, mitochondrial activation and heat production.
24196960 UCP1 can exist in different functional monomeric and associated states.
24138564 UCP1 -3826A/G and ADRB3 Trp64Arg polymorphisms may have a combined effect in the modulation of overweight/obesity and HDL-C levels in type 2 diabetes mellitus (T2DM) Caucasian-Brazilian patients
24086366 The season-specific effects of UCP1 on visceral fat area were consistent with a previous finding that active brown adipose tissue was more frequently found in winter than in summer.
24059847 All-trans-retinoic acid (ATRA) induces UCP1 expression in mouse adipocytes through activation of RARs, whereas expression of UCP1 in human adipocytes is not increased by exposure to ATRA.
23906633 VDR directly inhibits the expression of uncoupling protein-1 (UCP1).
23824424 UCP-1 is relatively abundant in epicardial fat, and this depot possesses molecular features characteristic of those found in vitro in beige lineage adipocytes.
23454374 High UCP1 expression is associated with pheochromocytoma.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
23134754 These data are consistent with FTO rs9939609 and UCP-1 rs6536991 common variants as contributors to obesity in the Brazilian population.
23043591 UCP-1 single nucleotide polymorphism A-3826G is associated with the dampness-phlegm pattern in Korean stroke patients.
23032405 UCP1 -3826 A/G substitution accelerates age-related decrease in BAT activity, and thereby may associate with visceral fat accumulation with age.
22764640 This study links the GG homozygous form of UCP1 with obesity and blood pressure among females only.
22750084 The present study demonstrates a sex-specific effect of genetic variants in UCP1 and SIRT3 on cIMT
22676960 UCP1 in HEK293 cell mitochondria is fully inhibitable and does not contribute to basal proton conductance.
22391136 Single nucleotide polymorphisms in UCP1 is associated with insulin resistance in morbid obese patients.
22277967 Strong candidate gene for mitochondrial disease, based on recessive mutations detected in infantile patients
22260858 Doenjang supplementation significantly reduced visceral fat and increased the free fatty acid concentrations in subjects with the G allele of the UCP-1 polymorphism.
22075692 Data indicate that triiodothyronine is an active modulator, which induces energy utilization in white adipocytes through the regulation of UCP-1 expression and mitochondrial biogenesis.
21959333 The present study demonstrated the interaction among beta3AR Trp64Arg, beta2AR Arg16Gly and UCP1 -3826A>G for the accumulation of visceral fat.
21878665 In human multipotent adipose-derived stem cells differentiated into functional brown adipocytes, activation of either beta(1)-adrenergic receptors or beta(3)-adrenergic receptors was able to increase UCP1 mRNA and protein levels.
21827845 Two variants located in the upstream enhancer region of human UCP1 gene affect gene expression and are correlated with human longevity.
21530798 The UCP1 gene -3826 G allele may result in smaller weight loss after a short-term, controlled-energy diet in young, lean women.
21355075 Data show that the abnormally expressed adipogenic UCP1 protein may serve as a unique marker.
21189472 Diminished resting energy expenditure (REE) in G-allele carriers as well as reduced thermoregulatory SNS activity for the G/G genotype, suggest that attenuated UCP1-linked thermogenesis has an adverse effect on the regulation of energy balance.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20803423 Associations between UCP1 polymorphism and a resistance to weight loss has been documented.
20803423 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20802238 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20709022 KLF11, but not KLF15, was essential for UCP1 expression during brown adipocyte differentiation of muBM3.1.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622171 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19966534 These results suggest that the G allele at -3826 in the UCP1 gene may ameliorate the reduction in serum HDL-C levels in obese women during low-calorie diet.
19966534 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19943796 the haplotype, A-C-Met, in the UCP1 gene is significantly associated with the increased genetic risk for developing type 2 diabetes in Asian Indians
19943796 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19895332 UCP1 gene is associated with hearing disorders among Japanese elderly.
19895332 Observational study of gene-disease association. (HuGE Navigator)
19806581 3826A/G polymorphism in the promoter of the uncoupling protein-1 gene was not associated with obesity in Chinese.
19753844 The -3826A/G allele is associated with an increased risk of type 2 diabetes in a northwestern Colombian population.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19567523 UCP-1 expression was similar in patients without and with severe coronary atherosclerosis and metabolic syndrome or type 2 diabetes.
19491387 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19474520 Polymorphic UCP1 (AG+GG) obese patients with low adiponectin levels appear to be high-risk subjects for worsening of liver steatosis, a NAFLD, possibly requiring a second-step evaluation by liver biopsy.
19474520 Observational study of gene-disease association. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19367093 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19076691 no significant associations between these UCP1 genetic polymorphisms and thigh fat areas, visceral fat areas, or blood biochemical profiles, in Korean women
19076691 Observational study of gene-disease association. (HuGE Navigator)
19056576 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18955781 UCP1 genetic polymorphisms are associated with blood pressure among Korean female subjects
18955781 Observational study of gene-disease association. (HuGE Navigator)
18755175 Observational study of gene-disease association. (HuGE Navigator)
18720901 Observational study of genotype prevalence. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18370824 Observational study of gene-disease association. (HuGE Navigator)
18305572 The expression of UCP1 mRNA was found in the human epidermis and was upregulated in differentiated keratinocytes.
18068010 These results suggest that the GG genotype may be an independent protective factor associated with low HDL-cholesterolemia in this population, although the role of the UCP-1 A-3826G polymorphism in HDL-C is complex and remains controversial.
18068010 Observational study of gene-disease association. (HuGE Navigator)
18059082 Observational study of gene-disease association. (HuGE Navigator)
17635070 Observational study of gene-disease association. (HuGE Navigator)
17635070 the GG genotype of UCP1 may be associated with the presence of hypertension in Japanese males and older subjects
17516293 Observational study of gene-disease association. (HuGE Navigator)
17516293 Possible involvement of the A-3826G polymorphism in the regulation of body composition.
17397545 Observational study of gene-disease association. (HuGE Navigator)
17242157 human uncoupling proteins 1 and 2 are activated by polyunsaturated fatty acids in planar lipid bilayers
16953057 Observational study of gene-disease association. (HuGE Navigator)
16953057 Our results indicated that young healthy Japanese men with the AG heterozygote of the A-3826G polymorphism in the UCP-1 gene showed higher BMI than those with other genotypes.
16896567 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16373902 Observational study of gene-disease association. (HuGE Navigator)
16338218 Observational study of gene-disease association. (HuGE Navigator)
16338218 These results suggest that insulin resistance caused by the -112C allele influences the susceptibility to type 2 diabetes.
16180337 Ectopic UCP1 gene expression in HepG2 cells affects ATP production.
16132835 Nuclear magnetic resonance study of this protein.
16084837 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16084837 UCP-1 polymorphisms have roles in body fat accumulation in Korean female subjects
15955458 Observational study of gene-disease association. (HuGE Navigator)
15955458 UCP1 has a new genetic polymorphism, with effects on body fat accumulation.
15865460 results of the present study provided insufficient evidence of the existence of a major [cleft lip/palate] susceptibility locus in the 4q region
15536594 Observational study of gene-disease association. (HuGE Navigator)
15536594 Our results agree with the previously reported association between UCP1 -3826G allele and obesity and point to a gender-related effect.
15355441 Polymorphisms in uncoupling protein 1 is associated with Type 2 Diabetes Mellitus
15281018 Observational study of gene-disease association. (HuGE Navigator)
15281018 the GG type of the UCP-1 gene has a strong association with increased LDL cholesterol level and might be a significant risk factor for hyper-LDL cholesterolemia among Korean obese subjects
15120704 Observational study of gene-disease association. (HuGE Navigator)
15120704 No association between the different polymorphisms and diabetic nephropathy.
14671150 Observational study of gene-environment interaction. (HuGE Navigator)
14671150 GG allele carriers have lowered capacity of thermic effect of a meal in response to fat intake. Impaired UCP1-linked thermogenesis can have adverse effects on regulation of body weight.
12951617 Observational study of gene-disease association. (HuGE Navigator)
12951617 the polymorphism -3826 A/G of the UCP1 gene is associated with a greater degree of obesity and very high figures of arterial tension.
12756473 Observational study of gene-disease association. (HuGE Navigator)
12756473 Uncoupling protein 1 polymorphisms are associated with waist-to-hip ratio.
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12565902 Data describe the expression of peroxisome proliferator-activated receptor gamma (PPAR gamma) co-activator 1, PPAR gamma, insulin receptor substrate-1, glucose transporter isoform-4, and mitochondrial uncoupling protein-1 in adipose tissue.
12395215 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12375583 The -3826A > G polymorphism of UCP1 does not play a major role in the development of obesity and/or disturbances of glucose metabolism.
12084707 Regulatory motifs for CREB-binding protein and Nfe2l2 transcription factors in the upstream enhancer of the mitochondrial uncoupling protein 1 gene.
12075579 Observational study of gene-disease association. (HuGE Navigator)
12032762 a new polymorphic site disrupts a consensus site for the binding of ATF/CREB transcription factor family and inhibits the factor binding in vitro
12029453 Observational study of gene-disease association. (HuGE Navigator)
11466580 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11439286 Observational study of gene-disease association. (HuGE Navigator)
11317671 Observational study of gene-disease association. (HuGE Navigator)
10999801 Observational study of gene-disease association. (HuGE Navigator)
10805511 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEG      1 - 70
RMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVR     71 - 140
LQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILAD    141 - 210
DVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGS    211 - 280
WNVIMFVCFEQLKRELSKSRQTMDCAT                                               281 - 307
//

Text Mined References (121)

PMID Year Title
26959981 2016 UCP1 and UCP3 Expression Is Associated with Lipid and Carbohydrate Oxidation and Body Composition.
26711342 2015 Post-transcriptional Stabilization of Ucp1 mRNA Protects Mice from Diet-Induced Obesity.
26458326 2016 UCP1 -3826 A>G polymorphism affects weight, fat mass, and risk of type 2 diabetes mellitus in grade III obese patients.
26332421 2015 Sirtuin/uncoupling protein gene variants and carotid plaque area and morphology.
26038550 2015 Uncoupling protein 1 binds one nucleotide per monomer and is stabilized by tightly bound cardiolipin.
25928572 2015 Effect of the beta-3 adrenergic receptor Trp64Arg and uncoupling protein 1-3826 A>G genotypes on lipid and apolipoprotein levels in overweight/obese and non-obese Chinese subjects.
25812254 2015 Association of UCP1 -3826A/G and UCP3 -55C/T gene polymorphisms with obesity and its related traits among multi-ethnic Malaysians.
25644605 2015 PRDM16 enhances nuclear receptor-dependent transcription of the brown fat-specific Ucp1 gene through interactions with Mediator subunit MED1.
25389910 2015 Thermogenic activity of UCP1 in human white fat-derived beige adipocytes.
25274455 2015 The gene polymorphisms of UCP1 but not PPAR ? and TCF7L2 are associated with diabetic retinopathy in Chinese type 2 diabetes mellitus cases.
25135951 2014 Taking control over intracellular fatty acid levels is essential for the analysis of thermogenic function in cultured primary brown and brite/beige adipocytes.
24804925 2014 Meta-analysis reveals the association of common variants in the uncoupling protein (UCP) 1-3 genes with body mass index variability.
24752406 2014 Association of the UCP polymorphisms with susceptibility to obesity: case-control study and meta-analysis.
24642703 2014 Reduced UCP-1 content in in vitro differentiated beige/brite adipocytes derived from preadipocytes of human subcutaneous white adipose tissues in obesity.
24342393 2014 Human white adipocytes express the cold receptor TRPM8 which activation induces UCP1 expression, mitochondrial activation and heat production.
24196960 2013 Expression, folding, and proton transport activity of human uncoupling protein-1 (UCP1) in lipid membranes: evidence for associated functional forms.
24138564 2014 The presence of at least three alleles of the ADRB3 Trp64Arg (C/T) and UCP1 -3826A/G polymorphisms is associated with protection to overweight/obesity and with higher high-density lipoprotein cholesterol levels in Caucasian-Brazilian patients with type 2 diabetes.
24086366 2013 Seasonal effects of UCP1 gene polymorphism on visceral fat accumulation in Japanese adults.
24059847 2013 Retinoic acid has different effects on UCP1 expression in mouse and human adipocytes.
23906633 2013 Cell-autonomous regulation of brown fat identity gene UCP1 by unliganded vitamin D receptor.
23824424 2013 Adult epicardial fat exhibits beige features.
23454374 2013 White-to-brown transdifferentiation of omental adipocytes in patients affected by pheochromocytoma.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
23134754 2012 The contribution of FTO and UCP-1 SNPs to extreme obesity, diabetes and cardiovascular risk in Brazilian individuals.
23043591 2012 Association of the UCP-1 single nucleotide polymorphism A-3826G with the dampness-phlegm pattern among Korean stroke patients.
23032405 2013 Impact of UCP1 and ?3AR gene polymorphisms on age-related changes in brown adipose tissue and adiposity in humans.
22764640 2012 Sex-dependent effects of the UCP1 -3826 A/G polymorphism on obesity and blood pressure.
22750084 2012 Association of the sirtuin and mitochondrial uncoupling protein genes with carotid intima-media thickness.
22676960 2012 Functional characterization of UCP1 in mammalian HEK293 cells excludes mitochondrial uncoupling artefacts and reveals no contribution to basal proton leak.
22391136 2012 The absence of polymorphisms in ADRB3, UCP1, PPAR?, and ADIPOQ genes protects morbid obese patients toward insulin resistance.
22277967 2012 Molecular diagnosis of infantile mitochondrial disease with targeted next-generation sequencing.
22260858 2012 Supplementation of Korean fermented soy paste doenjang reduces visceral fat in overweight subjects with mutant uncoupling protein-1 allele.
22075692 2012 Triiodothyronine induces UCP-1 expression and mitochondrial biogenesis in human adipocytes.
21959333 2011 Association between accumulation of visceral fat and the combination of ?3 adrenergic receptor Trp64Arg, ?2 adrenergic receptor Arg16Gly and uncoupling protein 1 -3826A>G polymorphisms detected by Smart Amplification Process 2.
21878665 2011 ??-Adrenergic receptors increase UCP1 in human MADS brown adipocytes and rescue cold-acclimated ??-adrenergic receptor-knockout mice via nonshivering thermogenesis.
21827845 2011 Two variants located in the upstream enhancer region of human UCP1 gene affect gene expression and are correlated with human longevity.
21530798 2011 Uncoupling protein 1 gene -3826 A/G polymorphism is associated with weight loss on a short-term, controlled-energy diet in young women.
21355075 2011 Human prostate cancer harbors the stem cell properties of bone marrow mesenchymal stem cells.
21189472 2011 UCP1 genetic polymorphism (-3826 A/G) diminishes resting energy expenditure and thermoregulatory sympathetic nervous system activity in young females.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20803423 2010 The effects of uncoupling protein 1 and beta3-adrenergic receptor gene polymorphisms on weight loss and lipid profiles in obese women.
20802238 2011 Population genetic analysis of the uncoupling proteins supports a role for UCP3 in human cold resistance.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20709022 2010 Transcriptional regulation of a brown adipocyte-specific gene, UCP1, by KLF11 and KLF15.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20622171 2010 Large copy-number variations are enriched in cases with moderate to extreme obesity.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
19966534 2009 Low-calorie diet-induced reduction in serum HDL cholesterol is ameliorated in obese women with the -3826 G allele in the uncoupling protein-1 gene.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19943796 2010 A haplotype at the UCP1 gene locus contributes to genetic risk for type 2 diabetes in Asian Indians (CURES-72).
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19895332 2010 The association between gene polymorphisms in uncoupling proteins and hearing impairment in Japanese elderly.
19806581 2009 [Analysis of -3826A/G polymorphism in the promoter of the uncoupling protein-1 gene in Chinese non-obese and obese populations].
19753844 2009 [Association between polymorphism in uncoupling proteins and type 2 diabetes in a northwestern Colombian population].
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19567523 2009 Uncoupling protein-1 and related messenger ribonucleic acids in human epicardial and other adipose tissues: epicardial fat functioning as brown fat.
19491387 2009 Severe obesity is associated with novel single nucleotide polymorphisms of the ESR1 and PPARgamma locus in Han Chinese.
19474520 2009 UCP1 -3826 AG+GG genotypes, adiponectin, and leptin/adiponectin ratio in severe obesity.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19367093 2009 Association study between candidate genes and obesity-related phenotypes using a sample of lumberjacks.
19076691 2008 A UCP1-412A>C polymorphism is associated with abdominal fat area in Korean women.
19056576 2009 Effects of novel capsinoid treatment on fatness and energy metabolism in humans: possible pharmacogenetic implications.
18955781 2008 Association of UCP1 genetic polymorphisms with blood pressure among Korean female subjects.
18755175 2008 Associations between polymorphisms in the mitochondrial uncoupling proteins (UCPs) with T2DM.
18720901 2008 Genetic profiling of genes from the oxidative stress pathway among North and South Indians.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18370824 2007 Absence of Association of Metabolic Syndrome with PPARGC1A, PPARG and UCP1 Gene Polymorphisms in Asian Indians.
18305572 2008 Expression of uncoupling proteins in human skin and skin-derived cells.
18068010 2008 Relationship between A-3826G polymorphism in the promoter of the uncoupling protein-1 gene and high-density lipoprotein cholesterol in Japanese individuals: a cross-sectional study.
18059082 2008 Association of ADRB1 and UCP3 gene polymorphisms with insulin sensitivity but not obesity.
17635070 2007 The uncoupling protein-1 gene -3826A/G polymorphism and hypertension in Japanese subjects.
17516293 2007 The UCP1 gene polymorphism A-3826G in relation to DM2 and body composition in Czech population.
17397545 2007 The uncoupling protein 1 gene, UCP1, is expressed in mammalian islet cells and associated with acute insulin response to glucose in African American families from the IRAS Family Study.
17242157 2007 Polyunsaturated fatty acids activate human uncoupling proteins 1 and 2 in planar lipid bilayers.
16953057 2006 A/G heterozygote of the A-3826G polymorphism in the UCP-1 gene has higher BMI than A/A and G/G homozygote in young Japanese males.
16896567 2006 [Candidate genes and polymorphism analysis in type 2 diabetes mellitus].
16373902 2006 Functional polymorphisms of UCP2 and UCP3 are associated with a reduced prevalence of diabetic neuropathy in patients with type 1 diabetes.
16338218 2006 Association of the -112A>C polymorphism of the uncoupling protein 1 gene with insulin resistance in Japanese individuals with type 2 diabetes.
16180337 2005 Ectopic UCP1 gene expression in HepG2 cells affects ATP production.
16132835 2005 GFT NMR based resonance assignment for the 21 kDa human protein UFC1.
16084837 2005 The effects of UCP-1 polymorphisms on obesity phenotypes among Korean female subjects.
15955458 2005 The finding of new genetic polymorphism of UCP-1 A-1766G and its effects on body fat accumulation.
15865460 2005 No evidence for linkage and association between 4q microsatellite markers and nonsyndromic cleft lip and palate in chilean case-parents trios.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15536594 2004 The Arg64 allele of the beta 3-adrenoceptor gene but not the -3826G allele of the uncoupling protein 1 gene is associated with increased leptin levels in the Spanish population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355441 2004 Common variants in beta2- and beta3-adrenergic receptor genes and uncoupling protein 1 as predictors of the risk for type 2 diabetes and body weight changes. The Finnish Diabetes Prevention Study.
15281018 2004 The effects of uncoupling protein-1 genotype on lipoprotein cholesterol level in Korean obese subjects.
15120704 Putative role of polymorphisms in UCP1-3 genes for diabetic nephropathy.
14671150 2003 The -3826 A-->G variant of the uncoupling protein-1 gene diminishes postprandial thermogenesis after a high fat meal in healthy boys.
12951617 [Influence of the polymorphism 03826 A --> G in the UCP1 gene on the components of metabolic syndrome].
12910269 2003 Cidea-deficient mice have lean phenotype and are resistant to obesity.
12756473 2003 Uncoupling protein 1 and 3 polymorphisms are associated with waist-to-hip ratio.
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12565902 2003 Reduced expression of PGC-1 and insulin-signaling molecules in adipose tissue is associated with insulin resistance.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12395215 2002 Polymorphisms in candidate obesity genes and their interaction with dietary intake of n-6 polyunsaturated fatty acids affect obesity risk in a sub-sample of the EPIC-Heidelberg cohort.
12375583 2002 Correlation of the -3826A >G polymorphism in the promoter of the uncoupling protein 1 gene with obesity and metabolic disorders in obese families from southern Poland.
12119988 2000 The human uncoupling protein-1 gene (UCP1): present status and perspectives in obesity research.
12084707 2002 Regulatory motifs for CREB-binding protein and Nfe2l2 transcription factors in the upstream enhancer of the mitochondrial uncoupling protein 1 gene.
12075579 2002 Genetic factors as predictors of weight gain in young adult Dutch men and women.
12029453 2002 Sudden infant death: no evidence for linkage to common polymorphisms in the uncoupling protein-1 and the beta3-adrenergic receptor genes.
11994670 2002 The uncoupling proteins.
11780125 2002 Superoxide activates mitochondrial uncoupling proteins.
11572862 2001 Brown fat UCP1 is specifically expressed in uterine longitudinal smooth muscle cells.
11466580 2001 Association between polymorphisms in candidate genes and morbid obesity.
11439286 2001 Synergistic effect of polymorphisms of uncoupling protein 1 and beta3-adrenergic receptor genes on autonomic nervous system activity.
11317671 2001 A polymorphism in the 5' untranslated region and a Met229-->Leu variant in exon 5 of the human UCP1 gene are associated with susceptibility to type II diabetes mellitus.
10999801 2000 Studies of the synergistic effect of the Trp/Arg64 polymorphism of the beta3-adrenergic receptor gene and the -3826 A-->G variant of the uncoupling protein-1 gene on features of obesity and insulin resistance in a population-based sample of 379 young Danish subjects.
10805511 2000 Synergistic effect of polymorphisms in uncoupling protein 1 and beta3-adrenergic receptor genes on long-term body weight change in Finnish type 2 diabetic and non-diabetic control subjects.
10772343 2000 Specific sequence of motifs of mitochondrial uncoupling proteins.
10620491 2000 The uncoupling protein homologues: UCP1, UCP2, UCP3, StUCP and AtUCP.
9398715 1997 Studies of genetic variability of the uncoupling protein 1 gene in Caucasian subjects with juvenile-onset obesity.
9119086 1997 Human mitochondrial import receptor, Tom20p. Use of glutathione to reveal specific interactions between Tom20-glutathione S-transferase and mitochondrial precursor proteins.
9054939 1997 Uncoupling protein-2: a novel gene linked to obesity and hyperinsulinemia.
8968850 1996 Additive effect of A-->G (-3826) variant of the uncoupling protein gene and the Trp64Arg mutation of the beta 3-adrenergic receptor gene on weight gain in morbid obesity.
7951471 1994 DNA polymorphism in the uncoupling protein (UCP) gene and human body fat.
3165741 1988 Detection of brown adipose tissue uncoupling protein mRNA in adult patients by a human genomic probe.
2380264 1990 Human uncoupling protein gene: structure, comparison with rat gene, and assignment to the long arm of chromosome 4.