Property Summary

NCBI Gene PubMed Count 30
PubMed Score 123.46
PubTator Score 60.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Anorexia 15
Heart failure 80
Disease Target Count Z-score Confidence
chronic kidney disease 90 3.978 2.0

Synonym

Accession Q96RP3 Q9BUG0
Symbols UR
SRP
URP
UCNI
UCN-II

Gene

PDB

2RMG   3N95  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (21)

PMID Text
26168276 The transcripts of TAS1R3 and UCN2 in peripheral blood cells may be considered potential biomarkers of consumption of sugary and fatty food, respectively, to complement data of food-intake questionnaires.
25426872 up-regulated in placenta, fetal membranes, and myometrium in labor
24835211 Corticotrophin-Releasing Factor (CRF) and the urocortins are potent regulators of the inflammatory phenotype of human and mouse white adipocytes.
24291344 Solubilized SUMO-eXact-preproUCN2 was used successfully to generate two high affinity mouse monoclonal antibodies specific to the pro-region of urocortin 2.
24249730 UCNII caused cell death via different membrane-disrupting mechanisms that involve aggregation & membrane depolarization in bacteria and pore formation in Leishmania even inside macrophages. Innate immune cells produce UCNII in response to infections.
24107226 UCN2 is significantly associated with AAA and inhibits VSMC proliferation by inducing a G1 cell cycle arrest suggesting a plausible regulatory role in AAA pathogenesis
23850799 Stresscopin-related peptide induces a weaker enhancement of cardiovascular function through corticotropin-releasing factor receptorn 2 than that induced by stresscopin.
23493376 Description of ucn2 posttranslational processing and peptide sequence. Hypoxia and glycosylation, paradigms that might influence secretion or processing of gene products, did not significantly impact hUcn 2 prohormone cleavage.
22000474 study showed that Ucn2 and Ucn3 differentially regulate the LPS-induced TNF-alpha and IL-10 expression and secretion in trophoblast explants acting through CRH-R2. Ucn2 is proinflammatory.
21454316 These data suggest a possible involvement of urocortin 2 and Ucn 3 in the mechanisms of endometriosis.
21360527 Confirm the anti-inflammatory function of VIP, through the modulation of the expression of CRF system that impacts in a reduction of mediators with inflammatory/destructive functions.
20670842 Unlike urocortin-1 levels, higher levels of urocortin 2 are not associated with worse left ventricular diastolic performance in patients with chronic systolic heart failure.
20616367 Placental Ucn2 and Ucn3 expression is sensitive to O(2) tensions and mediated by HIF-1alpha. In preeclampsia, the increased expression of both peptides may reflect a response to the oxidative stress.
20368512 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19417223 Urocortin 2 may play a role in the regulation of estradiol production throughout pregnancy, thereby contributing to the placental regulation of key reproductive events in pregnancy maintenance and parturition.
17074339 Both peptides were immunolocalized in epithelial, stromal, and endothelial cells.
16626608 UCN2 and UCN3 are expressed in human placenta, decidua, and fetal membranes and may be proposed as regulators of placental vascular endothelial tone.
16476507 the 38 amino acid urocortin 2 peptide is the minimal pharmacophore
16223946 data indicate that intracisternal Ucn 2 induced a central CRF(2)-mediated inhibition of gastric emptying involving sympathetic alpha(1)-adrenergic mechanisms independent from the vagus contrasting with the vagal-dependent inhibitory actions of CRF & Ucn 1
14592950 data suggest a distinctive role for corticotropin-releasing hormone receptor 2 specific agonists like urocortin II in the control of myometrial contractility during human pregnancy
14519439 SCP and UCN are potent activators of the p42/44 MAPK pathway, with SRP able to induce phosphorylation of p42/44 MAPK as well, albeit not as pronounced

AA Sequence

MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGS      1 - 70
RIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC                                 71 - 112
//

Text Mined References (32)

PMID Year Title
26168276 2015 TAS1R3 and UCN2 Transcript Levels in Blood Cells Are Associated With Sugary and Fatty Food Consumption in Children.
25426872 2015 Urocortin 2 role in placental and myometrial inflammatory mechanisms at parturition.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
24835211 2014 Corticotrophin-Releasing Factor (CRF) and the urocortins are potent regulators of the inflammatory phenotype of human and mouse white adipocytes and the differentiation of mouse 3T3L1 pre-adipocytes.
24291344 2014 A His6-SUMO-eXact tag for producing human prepro-urocortin 2 in Escherichia coli for raising monoclonal antibodies.
24249730 2013 Protective role of the neuropeptide urocortin II against experimental sepsis and leishmaniasis by direct killing of pathogens.
24107226 2014 Urocortin 2 is associated with abdominal aortic aneurysm and mediates anti-proliferative effects on vascular smooth muscle cells via corticotrophin releasing factor receptor 2.
23850799 2013 Intracerebroventricular injection of stresscopin-related peptide enhances cardiovascular function in conscious rats.
23493376 2013 Posttranslational processing of human and mouse urocortin 2: characterization and bioactivity of gene products.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22000474 2011 Effects of urocortin 2 and urocortin 3 on IL-10 and TNF-? expression and secretion from human trophoblast explants.
21454316 2011 Urocortin 2 and urocortin 3 in endometriosis: evidence for a possible role in inflammatory response.
21360527 2011 Mapping the CRF-urocortins system in human osteoarthritic and rheumatoid synovial fibroblasts: effect of vasoactive intestinal peptide.
20966082 2010 Structural basis for hormone recognition by the Human CRFR2{alpha} G protein-coupled receptor.
20670842 2010 Clinical significance of endogenous vasoactive neurohormones in chronic systolic heart failure.
20616367 2010 Hypoxia and preeclampsia: increased expression of urocortin 2 and urocortin 3.
20368512 2010 Association of polymorphisms in genes regulating the corticotropin-releasing factor system with antidepressant treatment response.
19417223 2009 Urocortin 2 stimulates estradiol secretion from cultured human placental cells: an effect mediated by the type 2 corticotrophin-releasing hormone (CRH) receptor.
18052377 2007 Common and divergent structural features of a series of corticotropin releasing factor-related peptides.
17074339 2006 Human endometrium expresses urocortin II and III messenger RNA and peptides.
16626608 2006 Urocortin 2 and urocortin 3 are expressed by the human placenta, deciduas, and fetal membranes.
16476507 2006 Modifications of the human urocortin 2 peptide that improve pharmacological properties.
16223946 2006 Urocortin 2 acts centrally to delay gastric emptying through sympathetic pathways while CRF and urocortin 1 inhibitory actions are vagal dependent in rats.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15476935 2004 Ancient evolution of stress-regulating peptides in vertebrates.
14592950 2004 Urocortin II is expressed in human pregnant myometrial cells and regulates myosin light chain phosphorylation: potential role of the type-2 corticotropin-releasing hormone receptor in the control of myometrial contractility.
14519439 2003 Protective effects of the urocortin homologues stresscopin (SCP) and stresscopin-related peptide (SRP) against hypoxia/reoxygenation injury in rat neonatal cardiomyocytes.
12615952 2003 International Union of Pharmacology. XXXVI. Current status of the nomenclature for receptors for corticotropin-releasing factor and their ligands.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11416224 2001 Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor.
11329063 2001 Human stresscopin and stresscopin-related peptide are selective ligands for the type 2 corticotropin-releasing hormone receptor.
11226328 2001 Urocortin II: a member of the corticotropin-releasing factor (CRF) neuropeptide family that is selectively bound by type 2 CRF receptors.