Property Summary

NCBI Gene PubMed Count 21
PubMed Score 27.71
PubTator Score 69.13

Knowledge Summary

Patent (3,188)

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis 1.100 2.5e-07
group 3 medulloblastoma 1.400 1.9e-03
atypical teratoid / rhabdoid tumor 1.400 6.8e-07
glioblastoma 1.200 3.8e-04
medulloblastoma, large-cell 1.900 2.2e-05
primitive neuroectodermal tumor 1.100 1.9e-03
non-small cell lung cancer 2.107 8.5e-18
lung cancer 4.000 1.3e-05
colon cancer 1.100 7.0e-03
Endometriosis -1.430 1.1e-02
lung carcinoma 1.100 8.5e-27
ductal carcinoma in situ 1.200 1.7e-03
invasive ductal carcinoma 1.600 2.2e-03
ovarian cancer 1.500 5.7e-08

Protein-protein Interaction (4)

Gene RIF (9)

PMID Text
23462292 Testicular germ cell tumor susceptibility associated with the UCK2 locus on chromosome 1q23.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19532987 The mechanism of phosphate transfer in UCK2 is shown to be concerted, and is accompanied by concerted proton transfer from the 5'-hydroxyl to a conserved active site aspartic acid that serves as a catalytic base
19064610 Observational study of gene-disease association. (HuGE Navigator)
18051367 HIV-1 NC upregulates uridine-cytidine kinase 2 in HEK 293T cells
17613536 B4GALT3, DAP3, RGS16, TMEM183A and UCK2--were significantly overexpressed in dup(1q)-positive ALLs compared with high hyperdiploid ALLs without dup(1q).
16484797 gene mapped to chromosome 1.
15280220 UCK2 is responsible for phosphorylation and activation of the antitumor activity of 3'-ethynyl nucleosides 1-(3-C-ethynyl-beta-D-ribopentofuranosyl)cytosine and 1-(3-C-ethynyl-beta-D-ribopentofuranosyl)uridine.
12199906 Increased intranuclear levels of UK may contribute to the metabolic build-up that is needed for Epstein-Barr virus nuclear protein EBNA-3-mediated B-cell blast transformation and rapid proliferation.

AA Sequence

MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTS      1 - 70
EQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAF     71 - 140
YSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPR    141 - 210
GADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH                       211 - 261
//

Text Mined References (26)

PMID Year Title
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23462292 2013 Testicular germ cell tumor susceptibility associated with the UCK2 locus on chromosome 1q23.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19532987 2009 Quantum mechanics/molecular mechanics investigation of the mechanism of phosphate transfer in human uridine-cytidine kinase 2.
19483681 2009 A genome-wide association study of testicular germ cell tumor.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17613536 2007 Tiling resolution array comparative genomic hybridization, expression and methylation analyses of dup(1q) in Burkitt lymphomas and pediatric high hyperdiploid acute lymphoblastic leukemias reveal clustered near-centromeric breakpoints and overexpression of genes in 1q22-32.3.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16484797 2006 Assignment of UCK2, ATF3 and RGS18 from human chromosome 1 to porcine chromosomes 4, 9 and 10 with somatic and radiation hybrid panels.
15735337 2005 Structure of human uridine-cytidine kinase 2 determined by SIRAS using a rotating-anode X-ray generator and a single samarium derivative.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280220 2004 A crucial role of uridine/cytidine kinase 2 in antitumor activity of 3'-ethynyl nucleosides.
15130468 2004 Structural basis for the specificity, catalysis, and regulation of human uridine-cytidine kinase.
12876357 2003 Crystallization and preliminary X-ray analysis of human uridine-cytidine kinase 2.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12199906 2002 Epstein-Barr virus encoded nuclear protein EBNA-3 binds a novel human uridine kinase/uracil phosphoribosyltransferase.
11494055 2001 Cloning and expression of uridine/cytidine kinase cDNA from human fibrosarcoma cells.
11306702 2001 Phosphorylation of uridine and cytidine nucleoside analogs by two human uridine-cytidine kinases.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8812458 1996 Isolation of three testis-specific genes (TSA303, TSA806, TSA903) by a differential mRNA display method.