Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.40
PubTator Score 2.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia 1.900 4.9e-02
acute quadriplegic myopathy 1.062 3.0e-04
Alzheimer's disease -1.100 4.8e-02
atypical teratoid / rhabdoid tumor 1.600 1.2e-06
autosomal dominant Emery-Dreifuss muscul... -1.203 2.9e-02
Becker muscular dystrophy -1.229 2.6e-02
dermatomyositis -1.200 5.8e-04
Down syndrome 1.600 1.3e-03
ependymoma 1.100 1.3e-02
Gaucher disease type 1 -1.300 1.1e-02
glioblastoma 1.400 1.1e-03
group 4 medulloblastoma 1.400 4.2e-03
hereditary spastic paraplegia -1.391 1.0e-03
juvenile dermatomyositis 1.313 6.8e-07
lung adenocarcinoma 1.020 1.1e-04
medulloblastoma, large-cell 2.000 6.1e-06
Multiple myeloma 1.152 8.5e-03
osteosarcoma 1.244 7.6e-05
ovarian cancer -1.600 6.3e-05
Pick disease -1.300 2.6e-06
primitive neuroectodermal tumor 1.100 2.7e-04
progressive supranuclear palsy -1.600 5.4e-03
Rheumatoid arthritis 2.200 2.5e-03

Gene RIF (2)

AA Sequence

MLWFQGAIPAAIATAKRSGAVFVVFVAGDDEQSTQMAASWEDDKVTEASSNSFVAIKIDTKSEACLQFSQ      1 - 70
IYPVVCVPSSFFIGDSGIPLEVIAGSVSADELVTRIHKVRQMHLLKSETSVANGSQSESSVSTPSASFEP     71 - 140
NNTCENSQSRNAELCEIPPTSDTKSDTATGGESAGHATSSQEPSGCSDQRPAEDLNIRVERLTKKLEERR    141 - 210
EEKRKEEEQREIKKEIERRKTGKEMLDYKRKQEEELTKRMLEERNREKAEDRAARERIKQQIALDRAERA    211 - 280
ARFAKTKEEVEAAKAAALLAKQAEMEVKRESYARERSTVARIQFRLPDGSSFTNQFPSDAPLEEARQFAA    281 - 350
QTVGNTYGNFSLATMFPRREFTKEDYKKKLLDLELAPSASVVLLPAGRPTASIVHSSSGDIWTLLGTVLY    351 - 420
PFLAIWRLISNFLFSNPPPTQTSVRVTSSEPPNPASSSKSEKREPVRKRVLEKRGDDFKKEGKIYRLRTQ    421 - 490
DDGEDENNTWNGNSTQQM                                                        491 - 508
//

Text Mined References (22)

PMID Year Title