Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.71
PubTator Score 4.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 4.6e-04
ovarian cancer 8520 2.8e-03
diabetes mellitus 1728 6.1e-03
osteosarcoma 7950 3.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Narcolepsy 72 3.832 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.100 6.1e-03
lung cancer 1.100 4.6e-04
osteosarcoma -1.221 3.3e-02
ovarian cancer -1.100 2.8e-03

Gene RIF (3)

AA Sequence

MAEGGGPEPGEQERRSSGPRPPSARDLQLALAELYEDEVKCKSSKSNRPKATVFKSPRTPPQRFYSSEHE      1 - 70
YSGLNIVRPSTGKIVNELFKEAREHGAVPLNEATRASGDDKSKSFTGGGYRLGSSFCKRSEYIYGENQLQ     71 - 140
DVQILLKLWSNGFSLDDGELRPYNEPTNAQFLESVKRGEIPLELQRLVHGGQVNLDMEDHQDQEYIKPRL    141 - 210
RFKAFSGEGQKLGSLTPEIVSTPSSPEEEDKSILNAVVLIDDSVPTTKIQIRLADGSRLIQRFNSTHRIL    211 - 280
DVRNFIVQSRPEFAALDFILVTSFPNKELTDESLTLLEADILNTVLLQQLK                       281 - 331
//

Text Mined References (19)

PMID Year Title