Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.00
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia 1.100 2.5e-02
astrocytic glioma 1.900 7.5e-03
ependymoma 2.000 3.4e-03
oligodendroglioma 2.000 1.7e-03
osteosarcoma 1.156 5.2e-04
ovarian cancer -1.100 9.8e-04
pancreatic ductal adenocarcinoma liver m... 1.514 7.0e-04
Pick disease 1.200 3.9e-05

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQVDVNIKLWKN      1 - 70
GFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKKNEICLSTKPVFQPFSGQGHRL     71 - 140
GSATPKIVSKAKNIEVENKNNLSAVPLNNLEPITNIQIWLANGKRIVQKFNITHRVSHIKDFIEKYQGSQ    141 - 210
RSPPFSLATALPVLRLLDETLTLEEADLQNAVIIQRLQKTASFRELSEH                         211 - 259
//

Text Mined References (13)

PMID Year Title