Property Summary

NCBI Gene PubMed Count 26
PubMed Score 660.24
PubTator Score 385.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.100 3.5e-06
psoriasis 1.500 2.5e-04

Gene RIF (8)

AA Sequence

MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLV      1 - 70
VKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLAS     71 - 140
RFLHPEVTETMEKGFSK                                                         141 - 157
//

Text Mined References (35)

PMID Year Title