Property Summary

NCBI Gene PubMed Count 26
PubMed Score 660.24
PubTator Score 385.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.100 3.5e-06
psoriasis 1.500 2.5e-04

Synonym

Accession P11441 Q5HY80
Symbols GDX
G6PD
GET5
MDY2
UBL4
TMA24
DX254E
DXS254E

Gene

PDB

4WWR   4X86   2DZI  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (8)

AA Sequence

MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLV      1 - 70
VKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLAS     71 - 140
RFLHPEVTETMEKGFSK                                                         141 - 157
//

Text Mined References (35)

PMID Year Title