Property Summary

NCBI Gene PubMed Count 30
PubMed Score 73.15
PubTator Score 45.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
aldosterone-producing adenoma -1.203 7.2e-03
atypical teratoid / rhabdoid tumor 1.100 7.7e-04
medulloblastoma, large-cell 1.500 1.1e-04
non-small cell lung cancer 1.062 7.7e-09
osteosarcoma -1.837 1.2e-06
ovarian cancer -1.100 2.8e-06
pancreatic cancer -1.200 2.5e-03
psoriasis -2.900 8.5e-06
subependymal giant cell astrocytoma -2.103 1.4e-02

Gene RIF (15)

AA Sequence

MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRENPPGPPIAASAPGPSQSLGLNVHNMTPATSPIGAS      1 - 70
GVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQSMDIDGVSCEKSMSQVDVDSGIENMEVDENDRREKR     71 - 140
SLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFLSSLSAQFKQNPKEVFSDFKDLIGQILMEVL    141 - 210
MMSTQTRDENPFASLTATSQPIAAAARSPDRNLLLNTGSNPGTSPMFCSVASFGASSLSSLYESSPAPTP    211 - 280
SFWSSVPVMGPSLASPSRAASQLAVPSTPLSPHSAASGTAAGSQPSSPRYRPYTVTHPWASSGVSILSSS    281 - 350
PSPPALASSPQAVPASSSRQRPSSTGPPLPPASPSATSRRPSSLRISPSLGASGGASNWDSYSDHFTIET    351 - 420
CKETDMLNYLIECFDRVGIEEKKAPKMCSQPAVSQLLSNIRSQCISHTALVLQGSLTQPRSLQQPSFLVP    421 - 490
YMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLALAAKECSLDSDYFKYPLMALGELCETKFGKTH    491 - 560
PVCNLVASLRLWLPKSLSPGCGRELQRLSYLGAFFSFSVFAEDDVKVVEKYFSGPAITLENTRVVSQSLQ    561 - 630
HYLELGRQELFKILHSILLNGETREAALSYMAAVVNANMKKAQMQTDDRLVSTDGFMLNFLWVLQQLSTK    631 - 700
IKLETVDPTYIFHPRCRITLPNDETRVNATMEDVNDWLTELYGDQPPFSEPKFPTECFFLTLHAHHLSIL    701 - 770
PSCRRYIRRLRAIRELNRTVEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACADAGLLDESFL    771 - 840
RRCLNFYGLLIQLLLRILDPAYPDITLPLNSDVPKVFAALPEFYVEDVAEFLFFIVQYSPQALYEPCTQD    841 - 910
IVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPAVQPRTQKFFEMIENHPLSTKLLVPSLMKFYTDVEHT    911 - 980
GATSEFYDKFTIRYHISTIFKSLWQNIAHHGTFMEEFNSGKQFVRYINMLINDTTFLLDESLESLKRIHE    981 - 1050
VQEEMKNKEQWDQLPRDQQQARQSQLAQDERVSRSYLALATETVDMFHILTKQVQKPFLRPELGPRLAAM   1051 - 1120
LNFNLQQLCGPKCRDLKVENPEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKM   1121 - 1190
RKAGIKSTIAIEKFKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILR   1191 - 1260
HLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH                               1261 - 1302
//

Text Mined References (43)

PMID Year Title